
Liberty Mutual
5 days ago
100% remote workbaton rougeduluthlalafayettelakevillemetairieminneapolismnnew orleanssaint paul
Title: Sales Representative, Inbound Remote
Location: Minneapolis, Minnesota, United States • Saint Paul, Minnesota, United States • Lakeville, Minnesota, United States • Duluth, Minnesota, United States • Baton Rouge, Louisiana, United States • New Orleans, Louisiana, United States • Metairie, Louisiana, United States • Lafayette, Louisiana, United States
Full-time
Remote
Job Description:
Apply Today - Training Classes in June 2026!
Are you ready to launch a rewarding career in insurance sales? We're seeking motivated, people-focused iniduals to join our Inside Sales Representative team. Secure your spot early for our upcoming 2026 training cohorts and take the first step toward a meaningful, growth‑oriented role.
Key Date:
- Licensed Class: June 1, 2026
- Unlicensed Class: June 29, 2026
Start your journey with us and build a career where your talent and passion for helping others truly make an impact.
As an Inside Sales Representative at Liberty Mutual, you'll have the tools, training and support you need to succeed from day one.
Plus, you'll enjoy:
- Generous earning potential
- Paid licensing and training opportunities
- Comprehensive benefits
- Flexible work arrangements
- Strong work-life balance
- And more!
Why Liberty Mutual?
Pay Details:
- Starting base salary is $45K with opportunity for growth + generous commission.
- Average first year earnings range from $55K-$75K through a combination of base salary and generous commission.
- Top Performing Agents in their second year and onward, can earn up to $85k+.
Our Sales Representative, Inbound Remote position is available to candidates based in the states of Minnesota and Louisiana. Applicants must reside within these specified locations to be considered for this role.
Positivity. Flexibility. Determination and a persuasive personality. Qualities like these cannot be taught. But they can be sharpened, strengthened, and appropriately compensated when you join Liberty Mutual Insurance as a part of our Contact Center Sales Organization. Bring your unique sales talent to our Fortune 100 company and receive paid-training, licensing in all 50 states, and a dynamic role that directs only warm leads your way (no cold calls) - because we believe in supporting your success, not holding it back. Join our sales team and realize the rewards of a career with unlimited earning potential, generous commissions, and a portfolio of benefits that start on day one.
Job Details
As an Inbound Sales Representative, you will be handling inbound calls and warm leads, consulting with potential and existing policyholders on their insurance needs and matching the correct coverages, products, and benefits to convert sales leads into policyholders.
You'd be a great fit if you are:
A Passionate Seller: When a lead comes in, you skillfully pick up the phone and use your sales expertise to turn prospects into happy, confident Liberty Mutual policyholders.
A Front Lines Liaison: You rise to the role of representing the Liberty brand, you believe in what you're selling, and you enjoy connecting customers to the right products for their inidual needs.
A Reliable Teammate: Whether you work at the office or from home, you adapt well to different environments, schedules, and the varying needs of our policyholders.
A Customer-Centric Closer: While sales is in your title, integrity is in your nature. That means you sincerely care that our customers get exactly the quality products and services they need to embrace today and confidently pursue tomorrow.
Position Details:
From day one you will begin paid training in a remote work environment. All Inbound Sales Representatives need to hold a Property & Casualty Insurance license. If you do not have one, no worries, paid training also includes licensing!
- Training extends over a period of 16 weeks for licensed hires and 18 weeks for unlicensed hires.
- Comprehensive medical benefits from Day 1.
- No cold calls, all incoming warm leads.
- Opportunities for rewards and recognition.
- Must be available to work a schedule of 4 weekdays and 1 weekend day with a mid-morning start time. Example 11am-8pm (CST). This schedule can be expected for a
minimum of 12 months before consideration for another shift.
- All computer equipment is provided. You must be able to maintain department work at home (W@H) requirements which include a professional workspace/room with a dedicated desk and wired (cable, fiber of DSL service) high-speed internet connection with a minimum 100 MBps download speed and 20 MBps upload speed. Liberty Mutual does not support satellite and mobile internet service
Qualifications
- 2-3 years sales experience preferred. 2 years of sales/service-related work experience required.
- Strong, engaging interpersonal and persuasion skills needed to close sales.
- Ability to communicate well to both prospects and customers.
- Excellent analytical, decision-making and organizational skills.
- Strong typing capabilities and PC proficiency.
- Property and Casualty License required after hire.
About Us
Pay Philosophy: The typical starting salary range for this role is determined by a number of factors including skills, experience, education, certifications and location. The full salary range for this role reflects the competitive labor market value for all employees in these positions across the national market and provides an opportunity to progress as employees grow and develop within the role. Some roles at Liberty Mutual have a corresponding compensation plan which may include commission and/or bonus earnings at rates that vary based on multiple factors set forth in the compensation plan for the role.
At Liberty Mutual, our goal is to create a workplace where everyone feels valued, supported, and can thrive. We build an environment that welcomes a wide range of perspectives and experiences, with inclusion embedded in every aspect of our culture and reflected in everyday interactions. This comes to life through comprehensive benefits, workplace flexibility, professional development opportunities, and a host of opportunities provided through our Employee Resource Groups. Each employee plays a role in creating our inclusive culture, which supports every inidual to do their best work. Together, we cultivate a community where everyone can make a meaningful impact for our business, our customers, and the communities we serve.
We value your hard work, integrity and commitment to make things better, and we put people first by offering you benefits that support your life and well-being. To learn more about our benefit offerings please visit: https://www.libertymutualgroup.com/about-lm/careers/benefits
Liberty Mutual is an equal opportunity employer. We will not tolerate discrimination on the basis of race, color, national origin, sex, sexual orientation, gender identity, religion, age, disability, veteran's status, pregnancy, genetic information or on any basis prohibited by federal, state or local law.

100% remote workus national
Title: Director, Sales
Location: All cities, All, United States
Job Description:
Employees can work remotely
Full-time
Company Description
Miratech helps visionaries change the world. We are a global IT services and consulting company that brings together enterprise and start-up innovation. Today, we support digital transformation for some of the world's largest enterprises. By partnering with both large and small players, we stay at the leading edge of technology, remain nimble even as a global leader, and create technology that helps our clients further enhance their business. We are a values-driven organization and our culture of Relentless Performance has enabled over 99% of Miratech's engagements to succeed by meeting or exceeding our scope, schedule, and/or budget objectives since our inception in 1989. Miratech has coverage across 5 continents and operates in over 25 countries around the world. Miratech retains nearly 1000 full-time professionals, and our annual growth rate exceeds 25%.
Job Description
We are seeking an experienced and dynamic Director, Sales to drive our new business acquisition. This inidual contributor role focused on helping clients with their customer experience (CX) journey using Genesys Cloud, Google CES, and Amazon Connect. The ideal candidate will have a proven track record of driving revenue growth and developing strategic relationships with key industry players.
Key Responsibilities
- Drive the full sales cycle for new business, from initial prospecting to closing, with a relentless focus on revenue growth.
- Build and execute winning GTM strategies that leverage our relationships with Cloud Service Providers and technology vendors to create a steady stream of co-selling opportunities.
- Act as a strategic advisor to clients, helping them understand how our engineering and managed services can enhance their CX outcomes.
- Collaborate closely with internal teams, including marketing, alliances, and sales engineering to ensure we bring the best of Miratech to every prospect.
- And perform other duties as may reasonably be required in alignment with the purpose of the role.
Qualifications
- 10+ years of experience in IT services or managed services sales, specifically within the CX and CCaaS domains.
- Demonstrated success closing complex, multi-stakeholder enterprise deals in IT services or managed services environments
- Closing multi year 7 figure opportunities.
- Proven track record of net-new logo acquisition, with demonstrated success winning first-time enterprise customers (not focused on renewals)
- Ability to position AI-enabled CX outcomes (automation, agent assist, analytics) as business value — not just technology features
- Deep expertise in the CSP ecosystem, with a visible history of selling or partnering with platforms like Genesys, Google, or Amazon.
- A strong "partner-first" sales mentality, with the ability to turn vendor relationships into high-quality lead generation.
- A consistent history of over-achieving sales quotas and a clear drive for results.
- Exceptional communication skills and the ability to build trust with C-level stakeholders quickly.
Additional Information
We offer:
- Culture of Relentless Performance: join an unstoppable technology development team with a 99% project success rate and more than 25% year-over-year revenue growth.
- Competitive Pay and Benefits: enjoy a comprehensive compensation and benefits package, including health insurance, and a relocation program.
- Work From Anywhere Culture: make the most of the flexibility that comes with remote work.
- Growth Mindset: reap the benefits of a range of professional development opportunities, including certification programs, mentorship and talent investment programs, internal mobility and internship opportunities.
- Global Impact: collaborate on impactful projects for top global clients and shape the future of industries.
- Welcoming Multicultural Environment: be a part of a dynamic, global team and thrive in an inclusive and supportive work environment with open communication and regular team-building company social events.
- Social Sustainability Values: join our sustainable business practices focused on five pillars, including IT education, community empowerment, fair operating practices, environmental sustainability, and gender equality.
* Miratech is an equal opportunity employer and does not discriminate against any employee or applicant for employment on the basis of race, color, religion, sex, national origin, age, disability, veteran status, sexual orientation, gender identity, or any other protected status under applicable law.

100% remote workcanadaon
Title: Digital Service Advisor
Location: Burlington (Harvester Rd), ON, 3027 Harvester Rd #302, Burlington, Ontario, Canada
Req #5225
Virtual•
Job Description:
We’re searching for a Digital Sales Advisor. Are you searching for new possibilities?
Westland Insurance Group Ltd has an exciting opportunity for a Digital Sales Advisor to work remotely in Ontario. Do you love to talk about insurance and provide exceptional client service? If so, you will love working for Westland! We are looking for a career-minded inidual who is focused on growing their insurance industry knowledge and experience. Expected Compensation: The expected hiring range for this role is $45,600 to $57,000 based on a 37.5-hour work week. Actual offered salary will depend on the successful candidate’s qualifications and experience, as well as market conditions for the role, and internal equity. Reason for Vacancy: This posting is to fill a current vacancy on our team. Discover what’s possible, with Westland. The Westland story is all about growth, and that means plenty of possibility for everyone on our team. Every day, Westland proves that building a great business means taking care of communities, clients, and each other with equal commitment. As we continue to open new doors, we're inviting amazing people like you to join us. This is a sales position and is great for someone with strong skills in forging new relationships, growing business, and working in a fast paced, collaborative environment. If that sounds like you then this might be the perfect opportunity to grow your career!Interested in learning more? Why you'll love Westland:An open, flexible and welcoming workplace
Plenty of opportunities to grow and learnAutonomy to drive your own successBe part of our inclusive culture, alongside an extraordinarily talented community of people with a wide variety of backgroundsA total rewards program that takes care of your financial, physical, and mental health Flexible paid Values Days to celebrate days important to youPaid Volunteer Days for employees as part of Amplifying Communities, a program to support causes that matter most to our employees and clientsWhy we’ll love You:
Laser-focused, you have a track record of achieving sales targets
Building authentic client relationships comes naturally to you Master time manager, you can prioritize your workload, plus you demonstrate confidentiality and discretion Ability to explain complex information in a simple mannerStrong written and verbal communication skills, an active listenerInsurance broker level 1 license and willingness to obtain level 2 ASAP is a must (Westland will support in obtaining)Experince with personal lines insuranceOnce here, you'll:Be a member of our inclusive culture, alongside an extraordinarily talented community of people with a wide variety of backgrounds.
Deliver superior customer service that promotes client retention Uncover clients’ business challenges and act as a client advocate identifying their needs and providing recommendations Assist clients with their insurance needs by utilizing basic knowledge of underwriting principles You have an inexhaustible curiosity and look for opportunities to grow your careerContact prospects through phone and emailRespond on a timely basis to incoming web leadsAchieve and excel monthly sales quotasAccurately record client activities in the compafbeneny’s databaseAs part of our commitment to transparency, we want to let you know that while our recruitment system includes AI capabilities, these are never used to screen, evaluate, or select candidates. The only AI functionality that Westland uses is for transcribing notes during candidate calls, and this occurs with your consent. These tools aren't used to make any hiring decisions throughout our recruitment process.
Want to get to know each other better? Send your resume our way.
100% remote workcanada
Title: Sales Manager 1 - Remote - 1 Year Contract
Location: remote Canada
Department: Sales & Marketing
JOB SUMMARY
Handles incoming leads for large groups (e.g.,0-50 room nights) and catering leads for hotels supported by the Canada Sales Office, in an assigned geographic area. Works with customers to align customer preferences with brand needs and actively up-sells each business opportunity to maximize revenues and drive customer loyalty. Verifies that business is turned over properly and in a timely fashion for quality service delivery. Drives customer loyalty by delivering service excellence throughout each customer experience.
CANDIDATE PROFILE
Education and Experience
Required:
• High school diploma or GED; 4 years experience in the sales and marketing, guest services, front desk, or related professional area.
OR• 2-year degree from an accredited university in Business Administration, Marketing, Hotel and Restaurant Management, or related major; 2 years experience in the sales and marketing or related professional area.
Preferred:
• Experience selling large group business experience, either at a property or in a sales office.
• Knowledge of the group sales process for all brands and how to close a sale.
• Team-based selling experience.
• Hospitality Management Degree.
CORE WORK ACTIVITIES
Managing Sales Activities
• Responds in a timely manner to incoming large group/catering opportunities that are within the parameters of the Group Sales team within the Sales Office.
• Refers opportunities to appropriate sales associate if business is outside the Group Sales parameters.
• Understands the overall market (e.g., competitors’ strengths and weaknesses, economic trends, supply and demand) and how to sell against them.
• Verifies that business booked is within hotel parameters.
• Closes the best opportunities for each property based on market conditions and inidual property needs.
• Executes and supports the operational aspects of business booked (e.g., generating proposal, writing contract, customer correspondence).
• Transfers accurate, complete, and timely information to property in accordance with brand standards.
• Up-sells each business opportunity to maximize revenue for inidual properties.
• Understands and utilizes company marketing initiative/incentives to close on business.
• Follows up on opportunities uncovered by sales executives.
• Implements process improvements and best practices.
• Leverages other Group Sales resources and administrative/support staff to achieve related revenue goals.
• Works with customers to align customer preferences with brand needs and actively up-sells each business opportunity to maximize revenues and drive customer loyalty.
• Verifies that business is turned over properly and in a timely fashion for quality service delivery.
• Handles incoming leads for groups (e.g.,0-50 room nights).
• Performs other duties, as assigned, to meet business needs.
Building Successful Relationships
• Works collaboratively with other sales channels (e.g., Market Sales, on-property resources) to establish coordinated sales efforts that are complementary and not duplicative.
• Drives customer loyalty through excellent customer service throughout the sales process.
• Serves the customer by understanding their needs and recommending appropriate features and services that best meet their needs.
• Builds and strengthens relationships with existing and new customers to enable future bookings.
• Builds and maintains strong working relationships with key internal and external stakeholders.
• Creates clear expectations for customers and properties throughout the sales process.
• Resolves guest issues that arise as a result of the sales process.
• Brings issues to the attention of Property and Group Sales leadership teams as appropriate.
At Marriott International, we are dedicated to being an equal opportunity employer, welcoming all and providing access to opportunity. We actively foster an environment where the unique backgrounds of our associates are valued and celebrated. Our greatest strength lies in the rich blend of culture, talent, and experiences of our associates. We are committed to non-discrimination on any protected basis, including disability, veteran status, or other basis protected by applicable law.
Notification to Applicants: Central Canada Sales Office takes seriously its obligations under provincial human rights and accessibility legislation (such as the Accessibility for Ontarians with Disabilities Act, 2005, the Accessibility for Manitobans Act, and Nova Scotia Accessibility Act). We are happy to provide accommodations to job applicants needing assistance. If you require an accommodation in relation to this job posting, our online application or an interview, please call or email and a member of our Human Resources team will respond to your request. Please note that this phone number and email are only for those iniduals who would like to request an accessibility accommodation as part of the recruiting process.
This posting is for an existing vacancy.
About the Team
Marriott International is the world’s largest hotel company, with more brands, more hotels and more opportunities for associates to grow and succeed. Be where you can do your best work, begin your purpose, belong to an amazing global team, and become the best version of you.
Job Info
- Job Identification26053758
- Job CategorySales & Marketing
- Job ScheduleFull time
- Locations 2425 Matheson Blvd. E. Suite 100, Mississauga, ON, L4W 5K4, CA
- Pay Range (US/Canada)$73,000 - $102,000 annually
- Bonus Eligible?Y
- Stock Package?N
- Additional Information1 year contract position

100% remote workus national
Title: Senior Living Advisor - Nationwide
Location: United States, Remote
Department: Customer Service
Job Description:
Brookdale is a Great Place to Be**:**
- Gracious hospitality and neighborliness for our residents and families.
- Home-like feel and all-around comfort for residents and visiting family members.
- Entertaining events and gatherings so our residents can find connections in groups and 1:1 settings.
- Industry leader in clinical care.
- Nationwide company with 589 communities as of November 30, 2025, offering many opportunities to grow and learn as a sales professional.
- Extensive corporate support including a robust training program.
Job Description
Make Lives Better Including Your Own. If you want to work in an environment where you can become your best possible self, join us! You’ll earn more than a paycheck; you can find opportunities to grow your career through professional development, as well as ongoing programs catered to your overall health and wellness. Full suite of health insurance, life insurance and retirement plans are available and vary by employment status.
Part and Full Time Benefits Eligibility
- Medical, Dental, Vision insurance
- 401(k)
- Associate assistance program
- Employee discounts
- Referral program
- Early access to earned wages for hourly associates (outside of CA)
- Optional voluntary benefits including ID theft protection and pet insurance
Full Time Only Benefits Eligibility
- Paid Time Off
- Paid holidays
- Company provided life insurance
- Adoption benefit
- Disability (short and long term)
- Flexible Spending Accounts
- Health Savings Account
- Optional life and dependent life insurance
- Optional voluntary benefits including accident, critical illness and hospital indemnity Insurance, and legal plan
- Tuition reimbursement
Base pay in range will be determined by applicant’s skills and experience. Role is also eligible for team based bonus opportunities. Temporary associates are not benefits eligible but may participate in the company’s 401(k) program.
Veterans, transitioning active duty military personnel, and military spouses are encouraged to apply. To support our associates in their journey to become a U.S. citizen, Brookdale offers to advance fees for naturalization (Form N-400) application costs, up to $725, less applicable taxes and withholding, for qualified associates who have been with us for at least a year.
The application window is anticipated to close within 30 days of the date of the posting.
Responsibilities
Builds a connection with families and help them care for their aging loved ones by matching them with one or more of nearly 700 Brookdale communities nation-wide, and by recommending that they take the next step to come and see how we enrich the lives of those we serve with compassion, respect, excellence, and integrity.
- Assists families who are looking for help with senior housing or other home-based assistance.
- Identifies the Brookdale communities or other resources that are the best fit for a family’s needs.
- Persuades people to take action by visiting Brookdale communities and learning about the options available to them that will improve their quality of life and schedules appointments for families to visit one or more Brookdale communities.
- Updates databases with customer/prospective customer status and changes, ensuring the quality of data meets all compliance requirements. Nurtures leads that are not yet ready to be forwarded to a particular community, supplying information that is related to the customer’s expressed interest or need, and with scheduled follow-up conversations to advance the lead toward choosing a community to visit as quickly as possible.
- Supports Brookdale communities through outbound calls and e-mails with the objective of updating the prospect’s situation and information within the database and scheduling appropriate follow-up activities within the database for the community sales associate, with an emphasis on setting an appointment for the prospect to visit the community.
- Works closely with community sales and operations associates as an extension of their sales team.
- Actively participates with supervisors and other team members in interactive training and coaching processes and department-wide culture building activities.
This job description represents an overview of the responsibilities for the above referenced position. It is not intended to represent a comprehensive list of responsibilities. An associate should perform all duties as assigned by his/her supervisor.
Qualifications
Education and Experience
A high school diploma or equivalent is required, with a Bachelor’s Degree (B.A or B.S) from a four-year college or university is preferred. Two years of experience in sales, pre-sales, inside sales, or appointment setting is preferred. Related experience in healthcare or call centers is also preferred.Certifications, Licenses, and Other Special Requirements
None.Management/Decision Making
Applies existing guidelines and procedures to make varied decisions. Uses sound judgment and experience to solve moderately complex problems based on precedent, example, reasonableness or a combination of these.Knowledge and Skills
Has a working knowledge of a skill or discipline that requires basic analytic ability. Has an overall understanding of the work environment and process. Has working knowledge of the organization. Possesses an understanding of the aging process and needs of older adults across all product lines. Ability to operate personal computers and related software. Ability to effectively manage time, tasks and projects in a dynamic environment is required. Ability to present self and Brookdale as an organization ready to meet the needs of the senior to maximize their quality of life by providing the highest quality of care and services. Ability to build trust and act honestly in relationships with others. Ability to assess and understand customers’ expectations, needs and circumstances. Ability to effectively listen and communicate verbally and in writing is essential. Must be a self-starter who excels in organizational and time-management skills and can work without close supervision.Physical Demands and Working Conditions
- Standing
- Walking
- Sitting
- Use hands and fingers to handle or feel
- Reach with hands and arms
- Stoop, kneel, crouch, or crawl
- Talk or hear
- Ability to lift: up to 25 pounds
- Vision
- Requires interaction with co-workers, residents or vendors
- Weekend, evening or night work if needed to ensure shift coverage
Brookdale is an equal opportunity employer and a drug-free workplace.
- Job Identification25021929
- Job CategorySales & Marketing
- Degree LevelHigh School Graduate
- Job ScheduleFull time
- Locations 105 Westwood Pl, Brentwood, TN, 37027, US(Remote)
- Hiring Range Minimum and Maximum Per Period$16.15 - $18.50 / hour
Title: Administrative Support, Scheduler
Location: USA, Remote
Job Description:
Staffing Solutions Organization LLC (SSO), an affiliate of Public Consulting Group LLC (PCG), is focused on delighting clients with world-class managed staffing and talent consulting services. SSO is committed to a erse workforce, which is a reflection of our clients and the people they serve.
Administrative Support, Scheduler
Illinois Home and Community‑Based Services (HCBS) Waiver – Quality Reviews
Location: Remote
Schedule: Full‑time | Monday–Friday, 8:00 a.m.–5:00 p.m. CTEmployment Type: Full‑TimeFLSA Status: Non‑ExemptPosition Overview
Staffing Solutions Organization (SSO) is seeking an Administrative Support / Scheduler to support the Illinois HCBS Waiver Quality Reviews project. This role is responsible for coordinating schedules, tracking project activities, maintaining documentation, and providing day‑to‑day administrative support to ensure reviews, interviews, travel, and deliverables remain on track and compliant with contract requirements.
The Administrative Support / Scheduler works closely with a supervisor, multiple nurse reviewers, and project leadership and serves as a central point of coordination for scheduling and review logistics.
Essential Duties & Responsibilities
- Coordinate and schedule nurse reviewer activities, including onsite review visits, remote reviews, interviews, and meetings.
- Manage and monitor multiple calendars to avoid conflicts and ensure appropriate regional coverage.
- Track completion of key project activities tied to contractual timelines and milestones.
- Serve as a point of contact for providers regarding scheduling and review process questions.
- Prepare and send clear, timely written communications related to schedules, changes, and expectations.
- Maintain confidentiality and safeguard sensitive information in compliance with HIPAA and project standards.
- Perform accurate data entry and maintain version control for project files and documentation.
- Support supervisors and project leadership with administrative, coordination, and ad hoc tasks as assigned.
Required Skills & Abilities
- Strong organizational skills with proven ability to manage multiple schedules simultaneously.
- High attention to detail and strong follow‑through when working with deadlines, trackers, and calendars.
- Ability to work independently while collaborating effectively with a fully remote team.
- Proficiency with standard office and project tools including Outlook, Excel, Teams, SharePoint, trackers, and dashboards; ability to quickly learn new systems and processes.
- Excellent customer service and relationship‑management skills, including strong verbal and written communication.
Experience Qualifications
- Minimum of 2 years of customer service experience required.
- Prior experience in administrative support, scheduling, or coordination roles required.
- Experience supporting healthcare, Medicaid, compliance, or contract‑based projects preferred.
Education
- High school diploma or equivalent required.
- Associate’s degree or higher preferred.
Work Environment
- Remote position
- Must be available during standard business hours: Monday–Friday, 8:00 a.m.–5:00 p.m. CT
- No supervisory responsibilities
Compensation for roles at Staffing Solutions Organization LLC (SSO) varies depending on a wide array of factors including, but not limited to, the specific office location, role, skill set, and level of experience. As required by applicable law, SSO provides a reasonable range of compensation for this role. In addition, SSO provides a range of benefits for this role.
Applicants must be authorized to work in the U.S. This position is not eligible for work authorization sponsorship (including H-1B sponsorship) by SSO and under the federal laws relating to the F-1 STEM EAD program, this position is not eligible to support a STEM EAD extension application.
All qualified applicants will receive consideration for employment without regard to race, color, religion, gender, sexual orientation, gender identity, marital status, age, national origin, protected veteran status, or disability. Staffing Solutions Organization LLC is an E-Verify participant.
Job Details
Pay Type
Hourly
Education Level
Equivalent Experience
Travel Required
No
Telecommute Percentage
100
Hiring Min Rate
16.83 USD
Hiring Max Rate
21.63 USD

100% remote workne or us nationalomaha
Sr Licensing Specialist
Location:
Omaha, Nebraska, United States of America
Job Description:
Location: This position is eligible for a hybrid or remote work schedule.Virtual•
WoodmenLife Home Office, 1700 Farnam Street, Omaha, Nebraska, United States of America
Job Description
Job Title: Sr Licensing Specialist
Location: This position is eligible for a hybrid or remote work schedule.
WoodmenLife is looking to hire a Sr Licensing Specialist to join our team!
The Senior Licensing Specialist serves as a subject-matter expert responsible for leading complex onboarding and licensing activities for a large, multi-channel producer population across the country. This role bridges compliance, operations, and distribution strategy by developing efficient processes, driving automation, and ensuring agents and partner firms are appointed accurately and on time. The position influences process design, manages high-risk cases, and ensures readiness for scalable channel growth while maintaining compliance to avoid regulatory penalties and support revenue growth through timely onboarding.WoodmenLife is one of the best places to work in Omaha, with more than 135 years of service rooted in purpose and community. Since 1890, WoodmenLife has been dedicated to helping hardworking Americans secure their families’ financial futures and leave a lasting legacy. As a purpose‑driven, not‑for‑profit life insurance company, our commitment is to our members and the communities they call home.
As a member of the WoodmenLife family, you’ll join others who share a commitment to family, community, and country. We offer a comprehensive benefits package including health, dental, vision, 401(k), life insurance, and more. Apply today to learn more!
We are looking for someone to:
- Provides excellent customer service to include handling complaint/error situations that result in customer satisfaction. Meet expectations with accurate, complete, and timely service. Foster effective business relationships with Sales Representatives, Regional Admins, Recruiting Sales Managers and Regional Directors. Receive incoming inquiries, analyze and refer to appropriate Recruiting Sales Managers when necessary. Explain contractual provisions, federal laws, state regulations and WoodmenLife guidelines.
- Meets expectations for attendance and punctuality in accordance with the expectations established by your supervisor and WoodmenLife policy.
- Ability to maintain highly confidential information.
- Own and manage complex contracting and appointment cases for both career and independent producers, partner firms, and distribution entities.
- Serve as a strategic liaison across Distribution Leadership, Compliance, Operations, and partner firms to support the rollout and growth of the independent channel, while acting as the primary resource for contracting and licensing inquiries from field leaders, commissions, and internal stakeholders.
- Draft, review, and interpret agent or firm contracts, amendments, and addenda; escalate exceptions appropriately.
- Lead due diligence for new distribution partners, including verification of E&O, AML, background checks, and hierarchy setup.
- Manage producer licensing, appointment, and renewals across all states and distribution channels.
- Interpret and apply state regulations; provide regulatory guidance to Sales Management, Legal, and compliance.
- Develop, document, and maintain workflows, checklists, and quality control procedures for contracting and licensing operations.
- Serve as internal system expert for the contracting/licensing platform; lead process improvements and automation initiatives.
- Perform audits and ensure internal controls to maintain regulatory compliance and data accuracy.
- Act as the go-to expert for contracting/licensing questions from field leaders, compliance, commissions, and partner firms.
- Provide input to leadership on contracting policies, SLAs, and best practices; identify and implement process enhancements.
- Mentor and train junior staff; lead internal knowledge-sharing sessions.
- Track, analyze, and report on key metrics (cycle time, backlog, error rates, compliance status) to identify improvement opportunities.
- Support cross-departmental initiatives such as automating onboarding workflows, system integrations, expanding operations into additional states, and coordinating the onboarding of new distribution partners to support organizational growth and efficiency
We need someone who has:
- Bachelor’s degree in Business, Finance, or related field, or equivalent experience.
- 3+ years of progressive experience in contracting, licensing, or distribution operations within life insurance or financial services.
- Experience supporting multi-channel environments (career, independent, or IMO/BGA relationships).
- Expertise interpreting state licensing regulations, appointment rules, and compliance requirements.
- Demonstrated ability to improve processes and implement workflow or system enhancements.
- Advanced proficiency in Microsoft Office and familiarity with contracting/licensing systems (e.g., SuranceBay, AgentSync, Vertafore).
- Strong communication and collaboration skills, with ability to influence across teams and departments.
- High attention to detail, sound judgment, and ability to manage sensitive and confidential information.
If you're ready to make an impact in your community, we’d love to hear from you. Apply today!
As part of WoodmenLife’s employment process, candidates will be required to complete a criminal background check, credit check (when required for position), fingerprint check (when required for position), drug screen and reference checks. Any offer of employment will be contingent upon successfully passing the above.
WoodmenLife is welcoming to all regardless of background and beliefs. WoodmenLife respects every associate’s unique perspective and contribution. We are committed to creating an environment that values differences, and creates opportunities for growth, leadership and service. This commitment includes providing equal opportunity in recruitment, employment and promotion, training and community outreach. WoodmenLife is also dedicated to strengthening the communities in which its employees live.
APPLICANTS WITH DISABILITIES SHOULD ADVISE THE HUMAN RESOURCES DEPARTMENT AT THE TIME OF APPLICATION IF SPECIAL ACCOMMODATIONS ARE NEEDED.
Woodmen of the World Life Insurance Society (WoodmenLife) is an equal opportunity employer.
Job Details
Pay Type
Hourly
Hiring Min Rate
20 USD
Hiring Max Rate
27 USD

100% remote workus national
Title: Reimbursement Analyst
Location: Fully Remote United States
At Gifthealth, we're revolutionizing the way people experience healthcare by simplifying the process of managing prescriptions and health services. Our mission is to provide a seamless, personalized, and efficient healthcare experience for all our customers. We're a dynamic, innovative, and customer-centric company dedicated to making a positive impact on people's lives.
Position Summary
A Reimbursement Analyst is responsible for being the primary point of contact in assisting patients or healthcare providers in obtaining access to therapy for the reimbursement hub program to which they are assigned. Primary activities may include researching and analyzing moderate to complex reimbursement policies, billing, benefit investigations, prior authorization, appeals and patient assistance support programs. Responsibilities, may include interactions with client contacts as well as handling of escalated cases/issues.
Key Responsibilities
- Assist patients and healthcare providers with moderate to complex billing and coding, insurance benefit investigations, prior authorization, appeals and patient assistance support programs inquiries.
- May include acting as regional contact for senior level client contacts.
- Manage patient cases and interact with external contacts like payers and other stakeholders.
- Assist with coordination of relevant tasks/activities between Gifthealth and the client.
- Review and resolve denied or underpaid insurance claims.
- Identify and assess patient specific insurance coverage options for client specific products.
- Reverify patient benefits at predetermined time frames
- Document all activities in program database within required timelines.
- Research payer medical policy
- Monitor and update payer prior authorization requirements and coverage policies for specified client program.
- Prepare and/or assist with preparation of reports as requested, including adverse event and product complaint reports.
- Review and process documentation to determine patient specific eligibility for client patient support program(s), as appropriate.
- Complete quality monitoring and quality assurance activities, as assigned.
- Travel to and attend client meetings, off-site training, and/or conferences. Travel time estimate: 5%.
Qualifications
- Minimum four years recent healthcare experience (2 years’ direct industry preferred).
- Exhibit proficiency in Microsoft Office products
- Excellent customer service skills (call center experience preferred).
- Advanced problem solving, research and analytical skills.
- Advanced communication skills, both written and verbal.
- Attention to detail, data entry accuracy required.
- Ability to multi-task and manage time independently.
- Client interaction experience preferred.
- Advanced knowledge of medical insurance (public and commercial), billing and
- coding and associated terminology.
Work Environment
- Location: Remote
- Schedule: Full-time
- May require availability or flexibility for escalations.
- Regular meetings with teams, departments, or leadership to ensure alignment.
Key Essential Functions
- Ability to sit for extended periods of time while working at a computer and on the phone throughout the workday.
- Ability to engage in continuous phone and computer use, including navigating multiple systems simultaneously, for the duration of the shift.
- Ability to perform repetitive motions for an entire shift, including typing, mouse use, and phone handling.
- Ability to view and read information on a computer screen for prolonged periods.
- Ability to communicate clearly and professionally via phone, email, and internal systems.
- Ability to manage a high volume of inbound and outbound calls while maintaining attention to detail and accuracy.
- Ability to work in a remote environment with minimal distractions and maintain productivity and performance standards.
- Ability to adapt to changing priorities, workflows, and processes in a fast-paced environment.
- Ability to meet attendance, schedule adherence, and performance expectations, including flexibility for occasional extended hours or weekends as business needs require.
Employment Classification
Status: Full-time
FLSA: Non-ExemptEqual Employment Opportunity (EEO) Statement
Gifthealth is an Equal Opportunity Employer and prohibits discrimination and harassment of any kind. All employment decisions are made without regard to race, color, religion, sex, sexual orientation, gender identity, transgender status, national origin, age, disability, veteran status, or any other legally protected status.
Disclaimer
This job description is intended to describe the general nature and level of work being performed. It is not intended to be an exhaustive list of all responsibilities, duties, or skills required of personnel. Gifthealth reserves the right to modify job duties or descriptions at any time.
Salary Description
$24.81 - $29.18
Title: Guide with People Management Experience
Location: New York, United States (Remote)
Department: Guides
Employment Type
Contractor
Minimum Experience
Manager/Supervisor
Compensation
$20/ Hr
Job Description:
ABOUT LIFEGUIDES
“More Casual Than Therapy, More Qualified Than a Friend”
More than a brand, we are a MOVEMENT. Our mission is to grow a community for sharing life experience and empathy, which impacts 1B lives in 15 years.
OUR PROMISE TO YOU
At LifeGuides, we believe it’s our responsibility to provide our Guides with the same level of compassion and care that we provide to our clients and their employees.
First and foremost, you will be surrounded by people who share common values:
C – put Community above self
L – lead with Love
E – Elevate humanity
A – Accountable to excellence through trust
R – build Resilience as we grow.
We will support you from the time you're onboarded and through continuous training.
Although experimentation and change are constant at LifeGuides, we will seek your input to strengthen our Guide Community and better support our members. We ask you to be patient and embrace change as it comes.
We will provide a fun, team-oriented, judgment-free environment where we can all learn from and support one another.
WHAT ARE THE BENEFITS OF BEING A LIFEGUIDE?
- You are an example and inspiration to people who are on their own journey through the full spectrum of life, from challenges to thriving.
- Do meaningful work helping others
- Join a growing movement, creating greater connection & caring in our society.
- Deepen relationships and personal growth.
- Continuing education to reach your full potential as a Guide and as a person.
- Access to free Guide sessions.
- A totally flexible schedule and remote working.
- Receive financial compensation for your work ($20/h - hours vary greatly from week to week - no guaranteed hours).
- Access to continuing education + live events taught by industry leaders
WHAT DO I NEED TO BECOME A GUIDE?
Have you successfully navigated a major life event? We want to learn more about you!
- Complete the Select Your Topic Form. (Note: Not completing steps 1 thru 3 automatically disqualifies your application.)
- Save your results as a PDF (Print > Save as PDF).
- Upload this saved PDF to BambooHR when prompted during the application process.
The drive to help and support others
A strong sense of empathy
A positive and encouraging attitude
Great listening skills
Time available for client calls
A deep desire to join a community of like-hearted people to improve the lives of others
An ability to adapt to an ever-changing environment
Be a Guide on the Side, LifeGuides gives you the opportunity to support an bring positive lasting change to others in your free time. You select your own hours but please note that this is barely a side hustle. You are compensated for your time but you may only get 5 hours a month
WHAT DO GUIDES DO?
- Have recurring sessions with members to listen, provide understanding and guidance, and ultimately help them build resilience and thrive.
- Share their experiences through content creation in the form of blog, video series, webinars, podcast.
- Participate in special projects aimed to increase the experience and operations of our Guide Community.
- Participate in ongoing training & development to optimize the member experience.
- Be active within our Guide Community to help others grow.
- Participate in client/member events.
REQUIREMENTS
- Have a PC desktop, Mac or laptop with a working camera and microphone (mobile devices such as tablets and smartphones cannot be used).
- Must have a reliable internet connection.
- Must have a dedicated workspace free of distractions.
- Possess intermediate computer skills.
- Must remain at your workspace for the entirety of sessions with members.
- Must be dressed appropriately (business casual) for video calls.
- Must be willing to create a video profile.
- Must be able to commit at least 5 hours a week to be available for member sessions (not guaranteed hours).

100% remote worksmyrnatn
Title: Virtual Care Specialist
Location: Smyrna, TN
Job Description:
Job Type
Full-time
Description
Spero Health is seeking a Virtual Care Specialist to join our awesome team in Smyrna, TN!
The Virtual Care Specialist is an important part of a collaborative team that works together to guide patients with substance use disorder throughout their treatment journey. You will be the point person for patients, so your ability to form lasting, high trust relationships will meaningfully impact their experience and overall success in the program. If you are looking for a career where you can make a difference in someone's life, Spero Health is the right place for you!
The Virtual Care Specialist responsibilities include, but are not limited to the following:
- Provide telephonic, text-based & video-based (telehealth) engagement and monitoring, assisted by decision support tools overseen by a prescribing clinician and broader clinical team.
- Work with patients to achieve their goals, identify new needs, and problem-solving by offering creative solutions to any known or perceived barriers to accessing care and report changes in status to the care team in a timely manner.
- Coordinate with patients and care teams for care planning and delivery by organizing schedules, managing appointments, referrals, and transitions of care and ensuring appropriate follow-up.
- Call in patient medication as directed by Physician.
- Input accurate patient information into electronic health record.
- Review the Prescription Monitoring Database.
- Provide education and resource information regarding medication.
Requirements
Education:
- High School Diploma required
- Graduation from an accredited program for Medical Assisting preferred
Experience:
- Medical Assistant certification preferred
- At least 2 years of experience in a customer service or healthcare environment
- Experience working on collaborative, erse and feedback – driven teams
BENEFITS:
- Medical, Dental, and Health Savings Account
- Vision, Life and Disability insurance (100% Company Paid)
- Generous PTO and paid holidays
- 401(k) retirement program with company match
- Wellness Programs (Fitness Reimbursement & Smoking Cessation)
- Employee Assistance Program (EAP)
- Discounts via Tickets at Work
CAREER DEVELOPMENT AND GROWTH
Opportunities for growth - we encourage our teammates to consider new growth opportunities with us.

100% remote workus national
Title: Events Planner
Location: Remote, United States
Requisition ID
2026-4313
Job Description:
Job Summary
The Events Planner will support the day-to-day management, planning, logistics coordination, execution, and closeout of complex NVSBE event activities for the VA OSDBU Direct Access Program. This role coordinates across multiple event workstreams, personnel groups, vendors, venues, registration activities, session logistics, exhibitor/sponsor operations, helpdesk support, and attendee-facing materials to ensure a seamless participant experience.
The Events Planner role requires a detail-oriented, proactive event professional who can manage complex logistics, coordinate multiple tasks and groups of personnel, develop high-quality work products and deliverables, and support on-site operations in a fast-paced federal event environment.
This position is remote. However, travel for in-person meetings, site visits, and on-site event execution is required.
Primary Responsibilities
- Support planning, initiation, management, execution, and closeout of complex NVSBE event activities and related contract support operations.
- Coordinate logistics inputs for the Comprehensive Event Logistics Plan, including registration setup, information booths, meeting rooms, plenary sessions, business opportunity sessions, learning sessions, networking roundtables, executive spaces, support rooms, signage, participant flow, setup, and tear-down.
- Manage assigned workstreams for attendee registration, participant scheduling, helpdesk operations, staffing support, volunteer coordination, venue room layouts, staff training, on-site support materials, and event communications.
- Coordinate with venues, hotels, transportation providers, food and beverage vendors, exhibit/decorating/tradeshow vendors, AV and Wi-Fi providers, security personnel, accessibility providers, photographers, videographers, and other event partners.
- Assist with agenda development, inidual schedules, room assignments, participant queuing, pedestrian flow, maps, signage placement, and daily agenda updates for the Joint Operations Center and on-site staff.
- Support planning and execution for networking roundtables, key leader roundtables, learning sessions, business opportunity sessions, general overview sessions, plenary lunches, receptions, and participant support services.
- Coordinate exhibitor and sponsorship logistics, including exhibitor packages, support ordering procedures, exhibit floor information, material schedules, storage, shipping, and booth support requirements.
- Prepare and maintain event deliverables, trackers, meeting minutes, reports, registration materials, program book content, participant event packages, website content inputs, presentation materials, and post-event products.
- Support on-site event execution by monitoring room setup, AV readiness, speaker materials, signage accuracy, information desks, hotel welcome desks, accessibility requests, customer service issues, and immediate technical or logistics deficiencies.
- Assist with event surveys and evaluations, participant attendance metrics, post-event materials, photographs/videos coordination, and After-Action Report inputs.
- Ensure assigned work products are accurate, timely, complete, customer-focused, compliant with accessibility and VA standards, and aligned with Government-approved plans.
- Provide professional customer service to participants, activity hosts, VA stakeholders, sponsors, exhibitors, vendors, and project team members before, during, and after the event.
Minimum Qualifications
- 12-15 years of substantive experience in day-to-day management of contract support operations involving multiple tasks and groups of personnel.
- Certified Government Meeting Professional (CGMP) or Certified Meeting Professional (CMP) certification.
- Associate’s degree or higher in a related field; additional relevant event planning experience may be considered in lieu of education where appropriate.
- Experience coordinating large-scale event logistics, including registration, staffing, agenda management, room layouts, exhibitor/sponsor support, AV, catering, signage, transportation, and post-event follow-up.
- Experience supporting federal clients, senior stakeholders, activity hosts, attendees, sponsors, exhibitors, vendors, and internal delivery teams.
- Proficiency using office automation equipment, Microsoft Office, Adobe software, collaboration tools, and event management or registration platforms.
- Strong written and verbal communication skills, with the ability to prepare accurate meeting minutes, reports, participant materials, instructions, and deliverable inputs.
- Strategic thinker with a forward-looking approach to marketing trends and technologies.
- Strong problem-solving skills and the ability to think critically.
- Ability to manage competing deadlines.
- Experience supporting complex projects and transformation efforts within the federal government.
- Comfortability with supporting complex client relationships.
- Ability to obtain and maintain a public trust clearance.
- Legal authorization to work in the U.S.
Desired Qualifications
- Strong critical thinking, analytical and time management skills.
- Proven ability to organize, prioritize and work well with others.
- Ability to communicate thoughts, ideas and solutions logically both written and orally.
- Ability to stay calm under pressure and in a fast-paced environment.
- Ability to receive feedback from clients and implement changes quickly and effectively.
- Ability to get up to speed quickly on complex issues.
- Desire to work in a fast-paced, rapidly evolving environment.
Client Information
The Department of Veterans Affairs (VA) Office of Small and Disadvantaged Business Utilization (OSDBU) serves as an advisor to the Secretary of Veterans Affairs on small business matters and supports VA’s mission by providing policy guidance, direction, and education to the VA acquisition community. Through the Direct Access Program, OSDBU facilitates direct access between Veteran-Owned Small Businesses, other small businesses, and procurement decision makers across government and the private sector. The NVSBE event is designed to maximize small business networking opportunities and may support more than 1,000 and up to approximately 4,000 attendees.
Title: Customer Insights Analyst
Location: Remote, United States
Job ID 2026-26997
Job Family Marketing
Job Description:
Overview
Lifeway is seeking a Customer Insights Analyst to provide advanced analytics support across Marketing, Sales, and Customer Support. This role will focus on customer segmentation, forecasting, campaign performance analysis, and delivering actionable insights that influence business decisions.
The Customer Insights Analyst leads complex analysis across customer behavior, marketing performance, and sales trends. This role partners cross-functionally to deliver insights that improve ROI, forecasting accuracy, and customer experience outcomes.
The ideal candidate will connect data to business outcomes be a strong communicator with non-technical stakeholders, have experience in multi-channel marketing environments and be fully comfortable working across multiple teams.
Why Lifeway?
Lifeway is a place where you can bring your faith and work experience to join in the most important mission in the world: making disciples of Jesus Christ. Whether you’re a creator or storyteller, data guru or problem-solver, or anywhere in between, if you’re passionate about serving the church, we have a place for you. Lifeway has a strong Work from Anywhere (WFA) culture that is deeply focused on our mission and values. While headquartered in Nashville, TN, many of our positions are remote-eligible and have autonomy and flexibility with work hours. We provide equipment and resources to ensure team members have access to a productive and ergonomic workspace. We believe building relationships and community is essential to how we work together, so Lifeway hosts all-team meetings several times per year and provides travel for key team gatherings for remote-based team members. Full-time employees are eligible for enrollment in our comprehensive benefits plans including healthcare, vacation and sick time, holiday pay, care days, 401(k) plan, maternity and paternity leave, adoption assistance, mission trip time, and more. If this sounds like a place where you would be excited to serve the kingdom of God, we would love for you to join our team.
Learn more about our culture at team.lifeway.com/culture-code
This is a remote position in the U.S. requiring minimal travel to Nashville for in-person team gatherings 2 - 4 times per year#LI-Remote
Responsibilities
- Lives out Lifeway’s mission and values, showing deep commitment to Kingdom work
- Advanced customer segmentation, LTV analysis, and churn modeling
- Forecasting models, pipeline reporting, and predictive analytics
- Campaign performance analysis across digital channels
- Cross-functional insight delivery to Marketing, Sales, and Support
- Data quality validation and reporting process improvements
- Informal mentorship of Analyst I team members
- Limited travel - approximately 2-4 times per year, typically overnight
Qualifications
Education
Bachelor's degree, required
Masters degree, preferred
Advanced graduate degree (PhD, etc.), not required
Skills, Knowledge, & Experiences, required
4+ years analytics experience
Strong SQL + Excel + BI tools
Experience with marketing or sales analytics
Exposure to forecasting / predictive modeling
Business Intelligence systems
SQL (advanced)
Excel (advanced)
Actively involved in an evangelical Christian church
Skills, Knowledge, & Experiences, preferred
Power BI
Python or R
A/B testing
Attribution modeling
Customer journey analytics
Title: E-Roster Administrator
Location: Mount Mckinley, Shrewsbury Business Park, Shrewsbury, SY2 6FG, Shropshire
Department: System Administration
Postcode
SY2 6FG
Major / Minor Region
Shropshire
Contract type & working pattern
Contract
Permanent
Hours
- Full time
- Flexible working
- Home or remote working
37.5 hours per week
Salary
£25,760 - £27,476 per annum
Salary period
Yearly
Grade
(NHS AfC: Band 3)
Specialty
Job Description:
Shropshire Community Health NHS Trust believes in fairness, equity and above all, values ersity in all aspects of its work, as a provider of health services and as an employer of people. We provide visa sponsorship to applicants who require this in order to have the right to work in the UK, providing that the role you have been offered meets the requirements set by the Home Office.
Applicants requiring a Skilled Worker Visa (such as data analysts, IT and finance professionals, etc) will need to meet the salary threshold of £41,700. For a limited number of clinical posts (listed here), applications to the Health and Care Visa route will need to meet the national pay scale for their role or the minimum salary threshold of £25,000 (whichever is higher). We advise that you check that the role you wish to apply for meets the requirement for sponsorship before applying.
Further guidance on eligible roles can be found here.
Job overview
Please note that this job does not meet the salary requirements for work visa sponsorship and as such we will be unable to progress your application if you do not have the right to work in the UK.
We are looking to recruit a systems administrator to provide a full and efficient administration support and data quality function in relation to the Trust’s E-Roster system.
You will support in maintaining the E-Rostering system, support in providing training to new and existing users, and assist in the creation of reports for a variety of audiences.
You will be qualified to NVQ 3 in business administration or have equivalent experience with a track record of delivering an efficient administrative support. You will have excellent customer service skills, experience of working with rosters, entering and maintaining data for large IT systems and of the use of a range of Microsoft packages.
You will be experienced in working with different departments and organisations with all levels of staff, utilising your communication skills.
Please note this vacancy may close early if a high volume of applications is received, we advise you submit your application early to avoid disappointment.
Advert
The successful candidate will provide an efficient, effective, streamlined and high-quality system administration service to the E-roster team located in Shrewsbury. Therefore, the ideal candidate will have excellent IT skills, experience with inputting and manipulating data, a confident telephone manner, strong organisational skills, enjoy working with people and thrive in a busy environment.
Working for our organisation
Shropshire Community Health NHS Trust provides community-based health services for adults and children in Shropshire, Telford and Wrekin, and some services in surrounding areas too. These range from district nursing, health visiting and running four community hospitals through to providing very specialist community care through talented and dedicated staff.
Patients, carers and the public play a vital role in helping us to develop and improve our services and we are constantly looking for ways to work with local communities, patients and the public to innovate and improve. Have a look at the Have Your Say section of our website to find out how you can feed back your experiences and help us to continually improve.
Shropshire Community Health NHS Trust is an exciting place to work. It offers a wide range of employment opportunities for many people.
Shropshire Community Health NHS Trust positively encourages applications from all areas of the community, regardless of age, gender, ethnicity, disability, sexual orientation or religious beliefs. We are committed to ensuring people who work for the community trust have a good working life - and a good work life/home life balance.
Detailed job description and main responsibilities
Please see the Job Description and Person Specification attached for further information on the role.
Title: Remote Escalation Engineer - MSP
Location: Brooklyn, New York, United States
Department: Support
Job Description:
This position is fully remote anywhere in the United States.
Ready to get off the IT machine and come be part of a team where you are more than a cog in the wheel? My IT Crew is the place where everyone gets a voice and new ideas are welcomed. Sound like this could be your new home? Keep reading….
My IT Crew has been a leader in the Managed Service provider space since 2016. We strive for excellence and achieve it.
- Our clients love us and our satisfaction surveys show it at a consistent 97%
- We are the team who always “has the cool stuff”, we adopt new tools to make us more efficient and allow us to help our clients with best-in-class support
- No more asking everyone for help, it's right at your fingertips. Having documentation that's actually useful? That's us!
- We Listen. Our culture of collaborative meetings and weekly team-led training will help YOU drive yourself and the company forward.
We are expanding our operations and seeking to grow our team. We have an opening for an Escalation Engineer to join our Service Delivery Team.
Escalation Engineer Duties and Responsibilities
- Be Fanatically awesome all the time!
- Be an active advocate for customer satisfaction
- Provide technical excellence t for systems, software, and hardware
- Document/Update internal Kb’s, SOP’s, Wiki’s
- Ask educated questions and listen to customers to determine the root cause of issues
- Work through the problem-solving process with customers, empowering them to do the same in the future
- Participate in training incoming staff
- Report significant and recurring issues
- Participate in the After Hours Escalation on-call rotation
Escalation Engineer Requirements and Qualifications
- Proven experience as a senior technical engineer, preferably in an MSP Environment
- Ability to diagnose and resolve advanced issues
- Excellent communication skills
- Keen attention to detail, the memory of patterns, and interest in problem-solving
- Consistently demonstrate the MyITcrew Core Values and meet standard metrics
- Current Microsoft, Azure or cloud computing, CCNA certifications or equivalent
- Advanced skills in the management of Active Directory Domain environments
- Proficient in networking, for both on-premise and cloud-based networks.
- A minimum of 5+ Years experience in support and engineering of Windows on-premise and cloud environments

100% remote workakcactde
Title: Bilingual - RN (Registered Nurse) - Remote| $35.50/hour | Starts 6/1/2026
Location: United States
Work Type: Remote
Department: Healthcare Support
Job Description:
Regular Full-Time
Overview
Looking for a registered nurse position that is challenging, will keep your clinical skills sharp, but being doing so from the comfort of home.
Compassion-driven, self-motivated, high-performing registered nurse.
Your critical thinking and clinical skills are top-notch.
Ready for a fast-paced position where you interact with patients through innovative channels, while keeping your clinical abilities sharp.
Want to work for an organization poised for unprecedented growth—that offers work-from-home options
Then we should talk.
Responsibilities
Carenet Healthcare Services is seeking RNs (Registered Nurses) to join our team of talented professionals who provide telehealth and virtual care clinical triage assessments, health education and other services to erse populations of patients and health plan members.
At Carenet Health, our nurses play an important role in helping healthcare consumers live their healthiest lives. You may not know our name, but odds are, our nurses or clinical staff have connected with you or someone you know as a trusted, behind-the-scenes partner for our clients—250+ of the nation’s premier health plans, health systems and their partners.
About 50,000 times a day, our compassion-focused teams guide people via phone, video, chat and other channels to high-quality and cost-effective care, coach them to improved wellness, and educate them about their healthcare resources and costs.
Our nurses and clinical staff support patients across the U.S. and around the world. Our fast-paced positions offer innovative work-at-home capabilities, plus the opportunity to keep your clinical skills sharp and have meaningful interactions with patients in a less physically demanding setting than a traditional clinical environment.
We take great pride in our disciplined, evidence-based protocols and inidual care approach. Our most effective clinical team members combine clinical expertise, critical thinking and the ability to develop a virtual, meaningful rapport in an empathetic way
By focusing on one patient at a time, you’ll leverage your clinical expertise, quick thinking and problem-solving skills to make a difference in thousands of lives every year.
Is this you?
Bring empathy and a passion for evidence-based care to all you do.
Multitasking and attention to detail are your superpowers.
You have a strong clinical background and believe part of your job as an RN is to advocate for your patients.
You roll with the punches on any given day, with any given interaction, and never lose sight of the need to use your stellar interpersonal and quick assessment skills.
You respect different cultures and know that rule-following is essential to your personal integrity and your employer’s quality compliance.
A typical week in the life of this position:
Work independently to make clinical decisions on routine patient care matters (at your license level)
Provide patient-focused care and guidance on the phone or online, including accurately assessing needs, delivering or directing to the appropriate level of care, identifying potential health problems and influencing people to make better health decisions
Communicate with our organization’s clients as needed and other team members, verbally and digitally
Monitor your own performance with dashboard metrics and look for ways to improve
Participate in coaching sessions to improve performance
Docment all patient/member interactions via management software
For eight consecutive years, Inc. Magazine has named Carenet as one of America’s fastest-growing private companies. You may not know our name, but odds are, we have connected with you or someone you know as a trusted, behind-the-scenes partner for our clients.
What’s important to us?
Being an integrity-driven organization that can truly change people’s lives
Serving others joyfully and inidually—we’re driven by the power of personal connection
Pioneering next-generation healthcare consumer and clinical engagement experiences
An entrepreneurial mindset
A work/life balance
Qualifications
What’s required:
If you can meet these position requirements below, please complete the following APPLICATION NEXT STEPS
- Complete our online assessments (please set aside at least 30 minutes)
- Must complete the assessment within 24-48 hours before the exam link expires. Assessment link will be available as soon as you have successfully complete your application.
A min of 3 years as a Registered Nurse with recent direct patient care experience; Three (3) years preferred in a high acuity level i.e. ICU, CC, ER, med-surg, telemetry, and or Tele - Health, Telephonic Triage.
Must currently reside and have a Multi-State (compact) unrestricted RN license in one of the following states: AL, AR, CO, FL, GA, IA, ID, IN, KS, KY, LA, ME, MS, MO, MT, NE, NM, NC, ND, NH, OK, SC, SD, TN, TX, VA, WI, WY
Ability to become licensed in additional states as required.
must be bilingual in English and Spanish.
Minimum of an associate's degree from a two-year technical college or technical school, or diploma nursing program; Bachelor's degree preferred
More important information:
Full-time positions available (36-40 hours per week)
Your schedule will include at least two weekend days every two weeks. Differential pay may be earned for certain shifts.
Training is 2-4 weeks, with the first two weeks during daytime hours. 100% Attendance is required. Training is done in a virtual, interactive classroom setting.
For work-from-home positions, your home office must meet certain certification requirements that would be explained to you during the interview process.
Req #: 5286

100% remote workaltuscaloosa
Title: Help Desk Coordinator II
Location: Remote, Tuscaloosa, Alabama, United States
Department: Hidden (42319)
Job Description:
Category
Hidden (42319)
Position Type
Regular
Overview
Are you prepared to embark on an exciting journey with us? WhiteSky is searching for a dedicated Tier 2 Help Desk Agent to become a valuable member of our vibrant team based in Tuscaloosa, Alabama.
About Us:
WhiteSky Communications is your trusted partner in delivering premium Internet and video services across various real estate sectors, including student housing, luxury apartments, adult living, and assisted living. We take pride in our commitment to providing comprehensive solutions on a large scale.
Position Overview:
As a Tier 2 Help Desk Agent, you will play a pivotal role in delivering top-tier support and ensuring a seamless experience for our customers. Your expertise will be instrumental in guiding our customers through troubleshooting steps for their network issues, addressing internet-related concerns on customers' devices, and effectively resolving network equipment issues.
Responsibilities
- Address network, device (e.g., laptops, cell phones, tablets, TVs, game consoles), and equipment issues, resolving them effectively.
- Accurately assess whether Tier I support tickets should be dispatched or escalated to Tier III for additional assistance.
- Conduct remote troubleshooting for network-related problems.
- Identify access points and evaluate their functionality, including heartbeats and the number of users.
- Determine the necessity of rebooting wireless access points to resolve connection issues.
- Utilize MAC addresses to ascertain the connection status of devices.
- Resolve cable and video-related issues.
- Reboot POE injectors, wireless access points, receiver racks, and other devices managed by the remote power controller.
- Rectify video and programming problems on Dish Smart Boxes.
- Handle matters escalated from property staff.
- Perform other duties as assigned.
Qualifications
Required:
- Possession of a High School Diploma or GED.
- Proficiency in network and wireless troubleshooting.
- More than 2 years of experience in customer service.
- Over 1 year of technical support experience.
- Strong written and oral communication skills.
- Exceptional telephone etiquette.
- Detailed documentation capabilities.
- Strong technical troubleshooting skills
- Exceptional problem-solving abilities
- A genuine passion for helping others
- Effective communication skills
- A desire to be an integral part of a dynamic and supportive team
KNOWLEDGE/SKILLS/ABILITIES
Required:
- Familiarity with Ruckus, Juniper, and Cambium Access Points.
- Experience with Zendesk or another ticketing system.
- Previous work experience with an Internet Service Provider (ISP).
Physical Demands and Working Conditions
The employee must have the ability to operate a personal computer and express or exchange ideas by means of the spoken word. May be required to sit and/or stand for long periods of time. Specific vision abilities required by this job include close vision, distance vision, color vision, peripheral vision, depth perception, and ability to adjust focus. May be required to lift or move 10+ pounds.
SALARY AND BENEFITS
- RealPage provides a competitive salary package along with a comprehensive benefit plan that includes:
- Health, dental, and vision insurance.
- Retirement savings plan with company match.
- Paid time off and holidays.
- Professional development opportunities.
- Performance-based bonus based on position.
Compensation may vary depending on your location, qualifications including job-related education, training, experience, licensure, and certification, that could result at a level outside of these ranges. Certain roles are eligible for additional rewards, including annual bonus, and sales incentives depending on the terms of the applicable plan and role as well as inidual performance.
Pay Range
USD $17.84 - USD $30.43 /Hr.

100% remote worklas vegasnv
Title: Senior Living Advisor - Las Vegas
Location: Remote Las Vegas, NV, United States
Department: Customer Service
Job Description:
About Us
Brookdale is a Great Place to Be**:**
- Gracious hospitality and neighborliness for our residents and families.
- Home-like feel and all-around comfort for residents and visiting family members.
- Entertaining events and gatherings so our residents can find connections in groups and 1:1 settings.
- Industry leader in clinical care.
- Nationwide company with 589 communities as of November 30, 2025, offering many opportunities to grow and learn as a sales professional.
- Extensive corporate support including a robust training program.
Job Description
Recognized by Newsweek in 2024 and 2025 as one of America's Greatest Workplaces for Diversity
Make Lives Better Including Your Own. If you want to work in an environment where you can become your best possible self, join us! You’ll earn more than a paycheck; you can find opportunities to grow your career through professional development, as well as ongoing programs catered to your overall health and wellness. Full suite of health insurance, life insurance and retirement plans are available and vary by employment status.
Part and Full Time Benefits Eligibility
- Medical, Dental, Vision insurance
- 401(k)
- Associate assistance program
- Employee discounts
- Referral program
- Early access to earned wages for hourly associates (outside of CA)
- Optional voluntary benefits including ID theft protection and pet insurance
Full Time Only Benefits Eligibility
- Paid Time Off
- Paid holidays
- Company provided life insurance
- Adoption benefit
- Disability (short and long term)
- Flexible Spending Accounts
- Health Savings Account
- Optional life and dependent life insurance
- Optional voluntary benefits including accident, critical illness and hospital indemnity Insurance, and legal plan
- Tuition reimbursement
Base pay in range will be determined by applicant’s skills and experience. Role is also eligible for team based bonus opportunities. Temporary associates are not benefits eligible but may participate in the company’s 401(k) program.
Veterans, transitioning active duty military personnel, and military spouses are encouraged to apply. To support our associates in their journey to become a U.S. citizen, Brookdale offers to advance fees for naturalization (Form N-400) application costs, up to $725, less applicable taxes and withholding, for qualified associates who have been with us for at least a year.
Responsibilities
Builds a connection with families and help them care for their aging loved ones by matching them with one or more of nearly 700 Brookdale communities nation-wide, and by recommending that they take the next step to come and see how we enrich the lives of those we serve with compassion, respect, excellence, and integrity.
- Assists families who are looking for help with senior housing or other home-based assistance.
- Identifies the Brookdale communities or other resources that are the best fit for a family’s needs.
- Persuades people to take action by visiting Brookdale communities and learning about the options available to them that will improve their quality of life and schedules appointments for families to visit one or more Brookdale communities.
- Updates databases with customer/prospective customer status and changes, ensuring the quality of data meets all compliance requirements. Nurtures leads that are not yet ready to be forwarded to a particular community, supplying information that is related to the customer’s expressed interest or need, and with scheduled follow-up conversations to advance the lead toward choosing a community to visit as quickly as possible.
- Supports Brookdale communities through outbound calls and e-mails with the objective of updating the prospect’s situation and information within the database and scheduling appropriate follow-up activities within the database for the community sales associate, with an emphasis on setting an appointment for the prospect to visit the community.
- Works closely with community sales and operations associates as an extension of their sales team.
- Actively participates with supervisors and other team members in interactive training and coaching processes and department-wide culture building activities.
This job description represents an overview of the responsibilities for the above referenced position. It is not intended to represent a comprehensive list of responsibilities. An associate should perform all duties as assigned by his/her supervisor.
Qualifications
Education and Experience
A high school diploma or equivalent is required, with a Bachelor’s Degree (B.A or B.S) from a four-year college or university is preferred. Two years of experience in sales, pre-sales, inside sales, or appointment setting is preferred. Related experience in healthcare or call centers is also preferred.Certifications, Licenses, and Other Special Requirements
None.Management/Decision Making
Applies existing guidelines and procedures to make varied decisions. Uses sound judgment and experience to solve moderately complex problems based on precedent, example, reasonableness or a combination of these.Knowledge and Skills
Has a working knowledge of a skill or discipline that requires basic analytic ability. Has an overall understanding of the work environment and process. Has working knowledge of the organization. Possesses an understanding of the aging process and needs of older adults across all product lines. Ability to operate personal computers and related software. Ability to effectively manage time, tasks and projects in a dynamic environment is required. Ability to present self and Brookdale as an organization ready to meet the needs of the senior to maximize their quality of life by providing the highest quality of care and services. Ability to build trust and act honestly in relationships with others. Ability to assess and understand customers’ expectations, needs and circumstances. Ability to effectively listen and communicate verbally and in writing is essential. Must be a self-starter who excels in organizational and time-management skills and can work without close supervision.Physical Demands and Working Conditions
- Standing
- Walking
- Sitting
- Use hands and fingers to handle or feel
- Reach with hands and arms
- Stoop, kneel, crouch, or crawl
- Talk or hear
- Ability to lift: up to 25 pounds
- Vision
- Requires interaction with co-workers, residents or vendors
- Weekend, evening or night work if needed to ensure shift coverage
Brookdale is an equal opportunity employer and a drug-free workplace.

hybrid remote worknew yorkny
Title: Founding Account Executive
Location: New York, New York, United States
Job Description:
Job description
Founding Account Executive @ Passionfroot
As our Founding AE, you’ll play a central role in scaling Passionfroot across mid-market and enterprise customers. Working closely with the CEO, GTM Lead and Growth & Ops teams, you’ll own the sales motion end-to-end, from building pipeline to closing deals, to driving long-term customer success on Passionfroot.
You’ll be responsible for turning early traction into a repeatable revenue engine: identifying high-value segments, refining positioning, and driving a structured, scalable approach to winning customers.
We’re entering a new phase: our AI agent 10x-ing how creator marketing is executed, Passionfroot is becoming the go-to place for top tech brands to run their creator-led GTM. You’ll help define what that looks like in practice, and educate customers about how this helps them scale.
We’re scaling fast, growing 13x YoY, and our customers include some of the most ambitious companies in tech—Replit, Figma, Gamma, Miro, and more—who rely on Passionfroot to scale creator partnerships as a core growth channel.
This is a unique opportunity to join a category-defining company that is reshaping how companies grow through creator led GTM.
What you'll achieve
Own the full GTM motion: Build and scale the sales funnel across our mid-market, and enterprise accounts, from outbound prospecting to closing, expansion, and retention.
Drive new business: Create and manage a high-quality pipeline, owning the full sales cycle including prospecting, pitching, negotiating, closing, and upselling. Collaborate with Growth & Ops teams to Identify high priority self-serve customer upsells to enterprise plans.
Operationalize inbound demand: Build systems to efficiently triage and prioritize our high volume of inbound, ensuring top customers are identified early and supported to maximize conversion & success on Passionfroot.
Work with top-tier customers: Build trusted relationships with marketing leaders at leading tech companies and creator marketing agencies.
Sales + Customer Success: Ensure customers succeed on Passionfroot by guiding them on creator strategy, campaign execution, and performance optimization.
Systematize & scale: Co-author the sales playbook, identify bottlenecks, and build systems that make our GTM motion repeatable and efficient.
Brand & Creator Strategy: Partner with customers to align brand goals with creator-led campaigns, continuously analyzing performance and driving improvements.
Voice of the customer: Capture insights from prospects and customers to inform product, positioning, and roadmap.
Evangelize the future of GTM: Stay ahead of trends across creator marketing, AI, and B2B growth—and translate that into compelling sales narratives for customers.
Host and lead events: Help organize and co-host occasional events (breakfasts, fireside chats, etc.) with top marketing leaders to build relationships, generate pipeline, and position Passionfroot at the center of the creator-led GTM conversation. Anticipate NY & SF Tech Weeks, and the occasional relevant conference.
Who we’re looking for
Location: Ideally based in New York and excited to be part of a small, high-impact founding GTM team, remote candidates considered.
Experience: 5+ years in B2B sales and/or customer success, ideally selling to marketers or growth teams.
Full-cycle ownership: Comfortable owning deals end-to-end in a fast-moving, ambiguous environment.
Builder mindset: You don’t just follow playbooks, you create them. You enjoy building systems, automations, and scalable processes from scratch.
AI-native: Comfortable using AI tools (e.g. Claude Code or similar) to automate workflows, improve productivity, and rethink how sales gets done.
Relationship-driven: Proven ability to build strong, long-term relationships with customers and consistently exceed targets.
Strong communicator: Exceptional written and verbal communication skills, with the ability to influence senior stakeholders.
Analytical: Comfortable working with data, identifying patterns, and making data-driven recommendations.
Ownership & ambition: Highly resourceful, proactive, and energized by operating in a fast-paced, zero-to-one environment.
Nice to haves
Experience selling GTM and marketing software, advertising, media, or sponsorships
Existing relationships with marketers at high-growth or enterprise tech companies
Our Offer
We’re a fast-growing startup at an inflection point—it’s an exciting time to join the team. You’ll get to work with top tech companies with the chance to make a significant impact and building a new market category.
There’s tangible stuff, too:
Competitive Compensation – A salary commensurate with experience.
Health Benefits – We cover 100% of employee health insurance premiums.
PTO Policy – You’ll have 21 days to request off each year, plus 11 holidays.
Fun team off-sites – We’ve been to Barcelona, Mallorca, South of France, Berlin, and the Baltic Sea.
Tools & Workspace – Latest Apple hardware.
At Passionfroot, you’ll find a place where you can grow fast, take ownership, and have real impact on how a new category is built. Even if your background doesn’t match perfectly, we encourage you to apply. You might be exactly who we’re looking for!
Remote, Hybrid
- New York, New York, United States
Sales
Thank you for applying!
There are so many great offerings out there and we're honoured that you applied to join our company.
We will review your application and get back to you as soon as we can.
Other jobs
You've already applied for this job
We appreciate your interest in this position. Unfortunately, you have already applied for this job.
Title: Patient Service Representative
Location: United States
Department: Patient Service Center
Job ID
2026-24220
Practice Name
North American Dental Group
# of Openings
1
Job Description:
MUST HAVE PATIENT CUSTOMER REPRESENTATIVE EXPERIENCE
$16 an hour
Join Us in Transforming the Dental Experience
Imagine being able to work with a group that strives to make a difference in the everyday lives of iniduals. At NADG, we use our iniduality and expertise to work with our partnered dental offices and ensure that every practice is able to focus on what they do best—providing best in class patient care. Our guiding principle is empathy, and it allows us to focus on the big picture of what our work is all about: putting every patient first, every visit.
Do you have the drive and passion for helping others improve the dental field in the way that we do? Come join our team— assist us in pioneering a new culture of dentistry.
Responsibilities
The Role You’ll Fill at NADG
Our Patient Service Center is expanding! As a member of our team, you will…
- Receives a high volume of calls to answer daily
- Present offers to patients
- Overcoming patient objections to schedule an appointment
- Scheduling a high volume of appointments
- Use product knowledge to showcase the solutions our practices can offer patients
- Use company databases and software to track progress
- Displays problem solving skills and takes ownership for patient concerns/issues and solutions
- Work with practice teams on solutions for patients in a timely manner
- Ability to manage sensitive and critical information with respect to company policies, as well as laws and regulations
- Collects missing information or updates outdated information
- Consistently meet and exceed department key performance indicators
- Expected to work all scheduled workdays, during scheduled hours and report to work on time
- Enjoy company contests and incentives
- Other special projects or responsibilities as assigned
Qualifications
The Skills We’re Looking for
As an ever-growing dental service organization, we are looking for team members with previous experience and impressive qualifications. These include…
- 2+ years’ experience providing superior customer service.
- Experience with M/S office products including Word, Excel, Outlook preferred.
- Strong computer skills: 45+ WPM, ability to multitask using different software and programs while maintaining a conversation
- Must have reliable high-speed internet
- Must have a private workspace from home
Benefits:
- Health, Dental and Vision Insurance (Full-time employees)
- Healthcare Spending Account
- Paid Time Off
- 401k
- Voluntary Life & Disability Insurance
- Referral Program
- Employee Discount Program
Ready to Join Our Team?
- Our team isn’t just looking for good members, we’re looking for the best of the best and are ready to welcome the perfect candidate to this position. NADG is constantly growing, and we want you to join us on our mission. Stop searching for jobs – apply today and start your career.
- If you are professional and organized yet outgoing, flexible, and energetic, you’ll fit right in.
- Our team is full of iniduals with different skills and personalities, but each is willing to go the extra mile for our patients while communicating well with our team. If this sounds relatable, then there’s a spot for you at our practice. We’re excited to hear from you!
Equal Opportunity Employer
We are an equal opportunity employer, and all qualified applicants will receive consideration for employment without regard to race, color, ancestry, religion, sex, sexual orientation, gender identity, age, national origin, disability, protected veteran status, or any other characteristic protected by law.
#NADG3
Title: Marketing Operations Coordinator - Dallas, TX
Location: Dallas US
Job Description:
Full Time
Marketing
Experienced
Integrative Emergency Services, LLC (“IES”) is looking for a Marketing Operations Coordinator to support the execution of marketing and communication initiatives across IES and its affiliated partners. This role is responsible for coordinating workflows, managing timelines, and ensuring operational follow-through across projects. The position partners with leadership, internal stakeholders, and external vendors to move initiatives from planning through completion in a timely, organized, and consistent manner. Work schedule is a hybrid format based at the Corporate office in North Dallas, 75244.
Integrative Emergency Services, LLC ("IES") is dedicated to cultivating best practices in emergency care, providing comprehensive acute care services, creating value, and supporting patients, employees, clients, providers, and physicians in pursuit of the highest quality in health care.
ESSENTIAL DUTIES AND RESPONSIBILITIES The responsibilities listed here represent the majority of the role but are not all-inclusive; other duties may be assigned.
- Own and manage intake, prioritization, and tracking of marketing and communications requests, ensuring clear communication, timely execution, and visibility across stakeholders
- Coordinate and execute marketing and communications initiatives across internal and external channels, ensuring timelines, deliverables, and approvals are met
- Draft, edit, and distribute internal and external communications, including announcements, newsletters, email campaigns, and organizational updates
- Manage project timelines and workflows across multiple concurrent initiatives, ensuring alignment with team priorities and deadlines
- Coordinate cross-functional efforts with internal stakeholders, leadership, physicians, and external vendors to support delivery of initiatives
- Support the coordination and execution of corporate events, conferences, training sessions, and company initiatives, including logistics coordination, timelines, and promotional materials
- Manage publishing and maintenance of approved digital content across organizational platforms, as assigned
- Coordinate production, ordering, and distribution of marketing materials, including collateral, promotional items, and event assets
- Maintain and organize marketing assets, brand resources, and project documentation across shared platforms (e.g., SharePoint, OneDrive, Teams, and Marketing Applications)
- Maintain and update communication distribution lists to ensure accuracy and effectiveness of outreach efforts
- Track and document initiative progress and completion to support team reporting and operational visibility.
QUALIFICATIONS
Knowledge, Skills, Abilities: To perform this job successfully, an inidual must be able to perform each essential duty satisfactorily.
- Strong written and verbal communication skills, with the ability to tailor messaging to varied audience.
- Strong organizational and project coordination skills with the ability to manage multiple priorities simultaneously
- High attention to detail and commitment to accuracy and brand consistency
- Ability to manage workflows, processes, and operational requirements across multiple stakeholders
- Ability to work independently and follow through on task with minimal supervision
- Strong problem -solving skills and ability to adapt in a fast-paced environment
- Proficiency in Microsoft Office Suite and familiarity with marketing tools (e.g., email platforms, content management systems, social media tools).
- Customer service mindset with responsiveness to internal stakeholders.
Education / Experience: Includes minimum education, technical training, and/or experience preferred to perform the job.
Required:
- Bachelor’s degree OR equivalent combination of education and experience
- 2+ years of relevant experience in operations, project coordination, marketing, communications, or related field
- Ability to travel to support events, including occasional local and overnight travel
Preferred:
- 3–5 years of relevant experience
- Experience supporting marketing or communications functions in a healthcare or corporate environment
- Experience managing workflows through project management or ticketing systems
- Experience working in a matrixed, multi-stakeholder environment
PHYSICAL DEMANDS: The physical demands described here are representative of those that must be met by an employee to successfully perform the essential functions of this job.
- Specific vision requirements include the ability to see at close range, distance vision, peripheral vision, depth perception, and the ability to adjust focus
- While performing the duties of this job, the employee is regularly required to talk and hear
- Frequently required to stand, walk, sit, use hands to feel, and reach with hands and arms.
- Possess the ability to fulfill any office activities normally expected in an office setting, to include, but not limited to remaining seated for periods of time to perform computer-based work, participating in filing activity, lifting and carrying office supplies (paper reams, mail, etc.)
- Occasionally lift and/or move up to 20-25 pounds
- Fine hand manipulation (keyboarding)
WORK ENVIRONMENT: The work environment characteristics described here are representative of those an employee encounters while performing the essential functions of this job. .
- This position follows a hybrid work model, typically 3 days in office
- Location: 4835 LBJ FWY, Dallas, TX, 75244
- Onsite presence will be required as business needs dictate.
- Standard business hours apply, with flexibility as needed to accommodate early mornings, evenings or occasional weekend projects and meetings.
- May visit hospital locations, vendors, and marketing event spaces
TRAVEL
- Some travel, including overnight and local, may be required as business needs dictate.
ADA & REASONABLE ACCOMMODATION STATEMENT:
IES is committed to providing equal employment opportunities to qualified iniduals with disabilities. In accordance with the Americans with Disabilities Act (ADA), reasonable accommodations may be made to enable iniduals with disabilities to perform the essential functions of the job. If you require accommodation during the application or employment process, please contact [email protected]. The company is committed to creating a erse, inclusive, and equitable environment and is proud to be an equal opportunity employer. Qualified applicants of any age, race, religion, nationality, sexual orientation, gender identity or expression, disability, or veteran status will receive equal consideration for positions. We welcome people of erse backgrounds, experiences, and abilities and believe that the unique experiences of our team drive our success.
100% remote workcosta rica
Title: Senior Threat Hunter
Location: Remote - Costa Rica
Job Description:
About Zscaler
Zscaler accelerates digital transformation to ensure our customers can be more agile, efficient, resilient, and secure. As an AI-forward enterprise, we are constantly pushing the envelope, leveraging the world’s largest security data lake to power our cloud-native Zero Trust Exchange platform. This innovation protects our customers from cyberattacks and data loss by securely connecting users, devices, and applications in any location.
Here, impact in your role matters more than title and trust is built on results. We say, impact over activity. We seek innovators who actively use AI to amplify their impact and who thrive in an environment where we leverage intelligent systems to stay ahead of evolving threats. We believe in transparency and value constructive, honest debate—we’re focused on getting to the best ideas, faster. We build high-performing teams that can make an impact quickly and with high quality. To do this, we are building a culture of execution centered on customer obsession, collaboration, ownership, and accountability.
We value high-impact, high-accountability with a sense of urgency where you’re enabled to do your best work and embrace your potential. If you’re driven by purpose, thrive on solving complex challenges, and want to be part of the team that’s helping to secure the AI age, we invite you to bring your talents to Zscaler and help shape the future of cybersecurity.
Role
We’re looking for a Senior Threat Hunter to join our team. The role will be located remote in Costa Rica reporting to the Director of Threat Hunting as part of the Zscaler Threat Hunting team.
This role is a customer facing role, responsible for delivering white-glove threat hunting deliverables to customers. As a Threat Hunter, you will split your time between exploring Zscaler customer telemetry to identify potential threats and interacting directly with customers to discuss these potential threats. For this position, we’re looking for someone to work standard business working hours with occasional on-call duties.
What You’ll Do (Role Expectations)
- Leverage deep, hands-on expertise in threat hunting, incident response, and security operations to proactively hunt, detect, defend, and advise for managed threat hunting customers
- Serve as a trusted security advisor to customers by writing and delivering tailored threat hunt findings, executive presentations, and strategic recommendations to a range of stakeholders from SOC analysts to CISOs
- Analyze customer web proxy telemetry against modern adversary Tactics, Techniques, and Procedures (TTPs) by utilizing SIEM-like tools (e.g. Splunk, Microsoft Sentinel, ElasticSearch) and by writing code (e.g. Python and SQL) to implement high-fidelity detection logic and actionable hunt hypotheses
- Review the output of detection engineering systems and the work of other analysts to continually improve our customer facing deliverables
Who You Are (Success Profile)
- You thrive in ambiguity. You're comfortable building the path as you walk it. You thrive in a dynamic environment, seeing ambiguity not as a hindrance, but as the raw material to build something meaningful.
- You act like an owner. Your passion for the mission fuels your bias for action. You operate with integrity because you genuinely care about the outcome. You adapt to what’s needed, navigating seamlessly between high-level strategy and hands-on execution.
- You are a problem-solver. You seek out challenges because you are energized by finding solutions, knowing that solving the hard problems delivers the biggest impact.
- You are a high-trust collaborator. You are ambitious for the team, not just yourself. You embrace our challenge culture by giving and receiving ongoing feedback—knowing that candor delivered with clarity and respect is the truest form of teamwork and the fastest way to earn trust.
- You are a learner. You have a true growth mindset and never stop developing yourself, actively seeking feedback to become a better partner and a stronger teammate. You love what you do and you do it with purpose.
What We’re Looking for (Minimum Qualifications)
- Bachelor’s degree in cybersecurity, computer information systems, computer science,, or a related field
- 3+ years in Threat hunting, Incident response, Cybersecurity consulting, Security operations, Malware analysis, Blue teaming, Purple teaming, Network defense with at least 1 of those focused on Threat Hunting or Consulting.
- Deep expertise in threat hunting
What Will Make You Stand Out (Preferred Qualifications)
- You've presented at cybersecurity industry conferences
- You’re familiar with Zscaler Internet Access (ZIA) telemetry
- You’ve briefed or presented to a wide range of cybersecurity professionals (from SOC analysts to CISOs)
#LI-Remote #LI-JG1 #LI-CostaRica
At Zscaler, we are committed to building a team that reflects the communities we serve and the customers we work with. We foster an inclusive environment that values all backgrounds and perspectives, emphasizing collaboration and belonging. Join us in our mission to make doing business seamless and secure.
Our Benefits program is one of the most important ways we support our employees. Zscaler proudly offers comprehensive and inclusive benefits to meet the erse needs of our employees and their families throughout their life stages, including:
- Various health plans
- Time off plans for vacation and sick time
- Parental leave options
- Retirement options
- Education reimbursement
- In-office perks, and more!
Learn more about Zscaler’s Future of Work strategy, hybrid working model, and benefits here.
By applying for this role, you adhere to applicable laws, regulations, and Zscaler policies, including those related to security and privacy standards and guidelines.

bangalorehybrid remote workindiaka
Title: Manager, Digital Client Success
Location: Bengaluru
Workplace: hybrid
Category: Client Success
Job Description:
About Bazaarvoice
At Bazaarvoice, we create smart shopping experiences. Through our expansive global network, product-passionate community & enterprise technology, we connect thousands of brands and retailers with billions of consumers. Our solutions enable brands to connect with consumers and collect valuable user-generated content, at an unprecedented scale. This content achieves global reach by leveraging our extensive and ever-expanding retail, social & search syndication network. And we make it easy for brands & retailers to gain valuable business insights from real-time consumer feedback with intuitive tools and dashboards. The result is smarter shopping: loyal customers, increased sales, and improved products.
The problem we are trying to solve : Brands and retailers struggle to make real connections with consumers. It's a challenge to deliver trustworthy and inspiring content in the moments that matter most during the discovery and purchase cycle. The result? Time and money spent on content that doesn't attract new consumers, convert them, or earn their long-term loyalty.
Our brand promise : closing the gap between brands and consumers.
Founded in 2005, Bazaarvoice is headquartered in Austin, Texas with offices in North America, Europe, Asia and Australia.
It’s official: Bazaarvoice is a Great Place to Work in the US , Australia, India, Lithuania, France, Germany and the UK!
The mission of the BV Client Success team is to increase the value of and drive satisfaction with the Bazaarvoice suite of services. Client retention and growth are areas of relentless focus as our teams help clients build and execute best-in-class User Generated Content (UGC) programs. By helping our clients maximize the value of their existing services, we ensure we can retain and grow those customers over the long term.
This candidate will lead our Digital Client Success team based out of Bengalore. This manager will oversee 5-6 Digital CSMs. They will be responsible for measuring those CSMs against defined metrics as well as creating additional reporting to better quantify success. This candidate will identify areas of opportunity within our Digital Portfolio and create programs to engage customers as well as making sure existing programs are being executed at a high level. Digital Client Success is also a source of talent within Bazaarvoice. This manager will be responsible for the continued growth of the CSMs on their team. This manager will also serve as a client-facing point of escalation when necessary, and must be comfortable working directly with clients.
Digital Client Success leverages a blend of 1:1, 1:many, and tech-driven client interactions, as well as a mix of proactive and reactive interactions. Digital Client Success also owns hosting responsibility for various webinars and helps record materials for our knowledge base.
What you'll be doing:
Working with peers and leadership in North America, EMEA, and APAC
Hiring, leading, coaching, and mentoring a team of dedicated Client Success professionals at various stages of their inidual careers
Strategically guiding existing processes, and aiding in the creation of new programs to drive product value at a rapidly increasing scale for our customers
Engaging in proactive client leadership outreach activities to further support client application of User Generated Content (UGC) best practices and to achieve targeted program goals
Building your team and guiding the career growth and development for your direct reports
Participating in the development of processes, tools, and systems that improve service delivery to clients; and contributing to the improvement of product design based on client/market feedback
Inspiring Customer Success excellence working cross-functionally throughout Bazaarvoice
Ongoing assignment of new accounts, maintenance of portfolio balancing among your direct report’s portfolios, and staff planning to account for growth
Participating in company-wide customer feedback activities including NPS surveys and additional ad hoc client feedback initiatives
Developing relationships with executive level leadership with accounts in your team’s portfolio
Necessary skills and experience:
Must have a strong track record of providing outstanding service to customers/clients/accounts
Five years of experience managing project or functional teams
Have managed the hiring process
Subject matter expertise in digital marketing, social media, e-commerce, and Web 2.0 technologies
Strong analytic background for both internal business analytics and consultation to clients
Experience with 1:many, scaled, queue-based support models
Exceptional written and verbal communication skills
Steller interpersonal skills for collaboration across internal teams in addition to clients
Ability to provide critical feedback and navigate challenging conversations with both internal and external stakeholders
8-10 years of experience working in a servicing capacity (customer service, consulting, account management, etc.); SaaS experience a plus
Strong experience utilizing Excel, PowerPoint, Salesforce.com, web meeting software and other tools in support of customer analysis, tracking and interactions
Experience with Gainsight is a plus
Working hours: 3:00pm – 12:00am IST
Must be able to work directly with clients in English
#LI-Hybrid#LI-SR1
Why join Bazaarvoice
Customer is key
We see our own success through our customers’ outcomes.
We approach every situation with a customer first mindset.
Transparency & Integrity Builds Trust
We believe in the power of authentic feedback because it’s in our DNA.
We do the right thing when faced with hard choices. Transparency and trust accelerate our collective performance.
Passionate Pursuit of Performance
Our energy is contagious, because we hire for passion, drive & curiosity.
We love what we do, and because we’re laser focused on our mission.
Innovation over Imitation
We seek to innovate as we are not content with the status quo.
We embrace agility and experimentation as an advantage.
Stronger Together
We bring our whole selves to the mission and find value in erse perspectives.
We champion what’s best for Bazaarvoice before iniduals or teams.
As a stronger company we build a stronger community.
Commitment to ersity and inclusion
Bazaarvoice provides equal employment opportunities (EEO) to all team members and applicants according to their experience, talent, and qualifications for the job without regard to race, color, national origin, religion, age, disability, sex (including pregnancy, gender stereotyping, and marital status), sexual orientation, gender identity, genetic information, military/veteran status, or any other category protected by federal, state, or local law in every location in which the company has facilities. Bazaarvoice believes that ersity and an inclusive company culture are key drivers of creativity, innovation and performance. Furthermore, a erse workforce and the maintenance of an atmosphere that welcomes versatile perspectives will enhance our ability to fulfill our vision of creating the world’s smartest network of consumers, brands, and retailers.

100% remote workus national
Title: Customer Technical Support
Location: Remote US
Job Description:
Company Description:
InEight is a leader in construction project controls software, empowering over 850 companies taking on challenging projects in industries including construction and engineering; transportation infrastructure; mining; water; power and renewables; and oil, gas and chemical. Uniquely suited to capital construction and other complex work, our integrated modular software manages projects with over $1 trillion globally.
Based in Scottsdale, Arizona, InEight supports a remote work model with employees working throughout the United States, Canada, Australia, Sri Lanka and Europe. InEight, an ISO 9001:2015-registered company, is a subsidiary of Kiewit Corporation (Kiewit). Kiewit, through its subsidiaries, is one of North America's largest and most respected construction and engineering organizations.
InEight is a fast-paced, innovative company comprised of high-energy teams of self-starters playing integral roles in shaping the future of capital projects around the world. Our industry-leading solutions, dedicated employees, and proven leadership team provide a solid foundation to support our continued growth and success.
We offer our fulltime employees a comprehensive benefits package that's among the best in our industry, including top-tier medical, dental and vision plans covering eligible employees and dependents, voluntary wellness and employee assistance programs, life insurance, disability, retirement plans with matching, and generous paid time off.
Position Summary:
The Customer Product Support position provides a great opportunity to become a product expert while providing support to our customers. Duties include taking inbound calls, providing functional support, troubleshooting, case management and providing overall support for InEight’s product software suite. The customers who work with you will end up as raving fans, because of your capability and your empathy. You’ll have a proven processes to guide you, along with the guidance of your peers and other industry professionals when you need it, and autonomy to make decisions on your own.
This role supports a FedRAMP authorized environment and handles sensitive data subject to agency-specific security and compliance regulations. As a result, candidates must be a U.S. Person, further defined as a U.S. Citizen.
*This is a remote position.
Job Responsibilities:
- Gather complete information from customers, document steps taken, researches the knowledgebase for known solutions, isolates cause and takes restorative actions while minimizing disruption to the customer's business operation.
- Acquire and maintain a strong functional working knowledge of InEight’s core products, with emphasis on the customer support aspect.
- Have the ability to walk customers through complex construction workflows specific to capital projects and other construction related projects.
- Provide functional support with project estimates and budget controls.
- Monitor and respond to customers inquires through InEight’s ticketing system in a timely manner.
- Act with an appropriate sense of urgency and follows up with customers to ensure issues are resolved to the customer's satisfaction.
- Facilitate remote meetings with customers and/or internal resources for troubleshooting and information gathering when necessary.
- Ability to adhere to customer SLA’s and escalate as needed.
- Will be required to participate in the on-call rotation, 1 week every 2 months 24/7 support.
Requirements:
- At least one year of prior software application developement or support and troubleshooting experience required
- Must be a U.S. Person, further defined as a U.S. Citizen
- Experience with Microsoft Office Suite of products and operating systems, experience with Excel Macro preferred
- Experience using Bluebeam and Adobe preferred
- Understanding and application of API integrations preferred
- Bug tracking experience required, Azure DevOps preferred
- Case tracking experience required, Service Now preferred
- Customer communication via phone and/or video required
- SaaS trouble shooting experience is ideal
- Deductive logic, complex problem solving and excellent trouble shooting skills
- Self-directed, able to prioritize and effectively handle many incidents at a time
- Exceptional customer service, organizational, and time management skills
- Excellent written and verbal communication skills
- A positive, willing and able attitude
Associate Member Services Specialist
Location: MN-Ramsey
Job Description:
Regular Full-Time
Requisition ID: 1285
Connexus Energy is looking for an Associate Member Services Specialist to serve our members as the first point of contact, providing them with exceptional service to ensure the best member experience possible. This role is responsible for answering member phone calls, analyzing data, and resolving residential and business member inquiries, while promoting programs and services.
Location:
Work for this position can be performed both on-site at our campus located at 14601 Ramsey Blvd, Ramsey, MN 55303, and from your local home office as duties require. While this position is designated as a hybrid role, based on current policy, hires must reside in or relocate within commuting distance to our office in Ramsey, MN.
Compensation:
The anticipated hiring range for this role is between $20.78 and $23.37 per hour. The final compensation offered is based on the selected candidate’s qualifications, experience and skill level. In addition, this position is eligible for an annual bonus with a target payout of 5% of annual earnings based on company performance.
In this position you will:
- Manage external member relationships, using multiple types of communication channels. Analyze, answer and resolve member issues to create quality member relationships.
- Collect delinquent residential and commercial accounts in a timely and professional manner, and within all appropriate guidelines.
- Promote and educate members on Conservation Improvement Programs (CIP) which align with our corporate strategic goals. Discuss our current incentives which are available or deemed a priority by Connexus and encourage members to participate in applicable programs.
- Communicate and work effectively with other departments and the community to meet our members’ needs.
Need to have:
- High school diploma or equivalent
- Two or more years’ experience in a customer service role
- Computer experience, including the ability to use and toggle between multiple screens, and a working knowledge of Word, Excel and Outlook
Nice to have:
- Inbound and outbound call center and/or collection experience
- Experience in a high-volume, inbound call center
- Ability to effectively work within a team environment and contribute to the achievement of departmental goals
- Must be focused on continuous learning, productivity and is results-oriented
Pre-Employment Requirement: Employment is contingent upon successfully completing a pre-employment background check and drug screen
Based in Ramsey, Connexus Energy is Minnesota’s largest electric cooperative, providing electricity, renewable energy alternatives and related services to 150,000 residential and commercial members just north of the Twin Cities. We offer a collaborative work environment with challenging and rewarding work, which provides for professional development and work-life balance in a highly technical, stable and innovative industry. We give back to the communities we have served for more than 80 years by embracing opportunities to volunteer, donate and support economic development. Our talented and friendly staff focuses on achieving our mission of powering our members and communities toward a smarter energy future with a passionate focus on affordability, innovation, safety, and grid reliability.
Connexus Energy’s benefits package includes medical/dental/vision insurance, health savings account with an employer contribution, flexible spending accounts, 401(k) plan with generous company matching and non-matching contributions and independent investment advisory services, accrued PTO, holiday pay, wellness days, tuition reimbursement, recognition program, employee referral program, charitable giving and employee activities. Company paid life insurance, short-term disability, and long-term disability is also provided.
Equal Opportunity Employer:
All qualified applicants will receive consideration for employment without regard to disability status, veteran status, or other legally protected status.

clevelandhybrid remote workoh
Job Description: CES Inside Sales Supervisor
Location:
Brooklyn Heights, OH, US, 44131
Workplace Environment: Hybrid
Company: AmeriGas Propane, Inc.
Requisition Number: 29425
When you work for AmeriGas, you become a part of something BIG! Founded in 1959, AmeriGas is the nation’s premier propane company, serving over 1.5 million residential, commercial, industrial and motor fuel propane customers. Together, over 6,500 dedicated professionals will deliver over 1 billion gallons of propane from 1,800+ distribution points across the United States.
Applications for this position will be accepted until .
Posting
Job Summary (Purpose):
The Inside Sales Supervisor (ISS) directly supervises the Inside Sales Reps (ISR) assigned to their team. In addition to achieving quota targets, the ISS is responsible for all aspects of Inside Sales, including the provision of daily operational oversight while utilizing established key performance measurements and best practices for ISRs taking inbound calls and making outbound sales and retention calls. The ISS provides effective coaching and performance management to ensure they attain inidual and team goals while meeting company standards.
Key Characteristics:
- Excellent sales technique and customer service orientation; able to provide very effective coaching and corrective feedback to build these skills in others.
- Proactively and effectively manages staff performance to ensure goals and standards are achieved; gives and receives feedback well.
Duties and Responsibilities:
- Responsible and accountable for the daily operation and the performance of a team of sales professionals to meet and/or exceed revenue, sales, and operational performance goals.
- Supervises, trains, and motivate sales representatives; ensure inidual and team performance to goals, service level agreements and quality metrics, in compliance with client expectations; uses performance management process when necessary.
- Sets and tracks sales targets; ensures that the pipeline is always filled with leads and prospects.
- Monitors/observes sales calls and activities to provide timely coaching to ISRs to improve sales effectiveness and productivity.
- Delivers/participates in product, process, and sales training.
- Tracks and reports metrics, KPIs, and data as required by leadership.
- Coaches and develops team members; conducts regular 1:1 feedback as well as preparing annual performance evaluations.
- Participates in recruitment programs and interviewing/selection to hire high quality iniduals as needed; effectively onboards new employees.
- Works collaboratively with peers, colleagues, and leadership across the organization to effectively implement new programs, achieve strategic business plans, and improve business performance.
Knowledge, Skills and Abilities:
- Demonstrated success in sales; able to teach/coach others on customer qualification, prospecting, sales messaging, value propositions, objection handling, and closing techniques.
- Working knowledge of contact center operations, key performance metrics, and expense management.
- Ability to make reasonable decisions and judgments in a dynamic environment.
- Ability to take independent action with general managerial direction.
- Ability to analyze statistical and performance data, develop management summary reports and proactively develop action plans.
- Strong knowledge of business systems and tools (including CRM, Microsoft office products, database, internet).
- Ability to effectively manage personnel and uses appropriate feedback and performance correction techniques to develop personnel.
Education and Experience Required:
- AA Degree or equivalent work experience. Bachelor’s degree a plus.
- Contact Center experience with demonstrated capability in leadership roles
- Experience in handling personnel-related issues, direct supervisory/management experience preferred
- Experience in statistical analysis of performance data.
Working conditions:
- Limited travel for occasional meetings required.
- Must be available to work varying schedules and hours including some weekends and holidays as workload requires.
AmeriGas Propane, Inc. is an Equal Opportunity Employer. The Company does not discriminate on the basis of race, color, sex, national origin, disability, age, gender identity, sexual orientation, veteran status, or any other legally protected class in its practices.
AmeriGas is a Drug Free Workplace. Candidates must be willing to submit to a pre-employment drug screen and a criminal background check. Successful applicants shall be required to pass a pre-employment drug screen as a condition of employment, and if hired, shall be subject to substance abuse testing in accordance with AmeriGas policies. As a federal contractor that engages in safety-sensitive work, AmeriGas cannot permit employees in certain positions to use medical marijuana, even if prescribed by an authorized physician. Similarly, applicants for such positions who are actively using medical marijuana may be denied hire on that basis.
The pay for this position ranges from $70,000.00 to $70,000.00 , depending on circumstances including an applicant’s skills and qualifications, certain degrees and certifications, prior job experience, market data, and other relevant factors. Additional compensation may include eligibility to earn a performance-based bonus or commissions on completed sales depending on position.
This is the Company’s good faith and reasonable estimate of the range of compensation for this position as of the time of posting. The Company offers a wide array of comprehensive benefit programs and services including medical, dental, vision, flexible spending and health savings accounts to our benefits-eligible employees. Additional benefits include retirement savings plans like 401(k) and paid days off such as parental leave, military leave, vacation/paid time off, sick leave in compliance with state law, as applicable, paid holidays, and disability coverage. Some benefits offerings are subject to any legal requirements or limitations, employee eligibility status, and where the employee lives and/or works.
Nearest Major Market: Cleveland

dry ridgekyno remote work
Verizon Value Field Representative
Location: Dry Ridge United States
Retail Field | Super SKU Program
About the Role
Are you driven by sales, energized by customer interaction, and excited to represent a world-class wireless brand?
As a Verizon Value Field Sales Representative, you will serve as the in-store ambassador for Verizon Value products across assigned retail locations. You will drive awareness, educate customers, and convert conversations into sales by delivering confident, solution-oriented experiences.
Availability
July 6 th -December 31, 2026 (possible of an extension)
Weekly hours available:
36 hours/week - Wednesday to Sunday availability
Wage
- $20/hour + a bonus compensation element
RESPONSIBILITIES
Proactively engage customers to uncover needs and purchasing intent
Deliver compelling demonstrations of devices, plans, and promotions
Clearly explain pricing, features, and value propositions
Close sales and guide customers through purchase decisions
Build strong relationships with store leadership and associates
Coach and influence store teams to drive brand advocacy
Maintain merchandising, signage, and display standards
Track performance, customer interactions, and KPIs
Share insights on market trends and competitive activity
QUALIFICATIONS
High School Diploma or GED
1+ year retail or customer-facing experience preferred
Strong communication and interpersonal skills
Comfort using digital tools and reporting platforms
Ability to stand for extended periods and lift up to 10 lbs
Why Join the Super SKU Program
High-visibility retail sales initiative
Represent a leading wireless brand
Growth, recognition, and advancement opportunities
Supportive, performance-focused leadership
ABOUT US
Typically, a mosaic is where all the pieces fit together nicely. That’s not us. This Mosaic is where every piece stands out. That’s because each person at our agency brings their own, unique set of skills to every brief, build, interaction, reaction, design and idea.
As part of the Acosta Group, Mosaic is one of the original marketing agencies who specialize in interactions, experience isn’t just what we have, it's what we create. With 3,000+ team members and hubs in Toronto and Dallas, we’ve spent over 35 years bringing brands to life through experiential marketing, integrated commerce campaigns, and field sales strategies that drive real behavior change.
From awareness, to earned, brand equity, consideration, and sales — we approach every project with people in mind, regardless of the channel or discipline. The result is an idea that can spark emotion and create action — whether it’s a sale or a smile. We celebrate bold thinking and embrace curiosity as we shape what’s next.
Acosta Group is an equal opportunity employer and will ensure that applicants with disabilities are provided with reasonable accommodations. If reasonable accommodation is needed, please contact [email protected] . Be sure to include "Applicant Accommodation" in the subject of your email to expedite the request.
Acosta Group believes in good faith that the minimum and maximum annual salary or hourly compensation range for this opportunity is accurate and reasonable at the time of posting.
The Acosta Group utilizes E-Verify for validating the ability to work in the United States for all job candidates. If you want more information on what this entails and your rights as a job applicant, please use the link provided to access information on our use of E-Verify and your right to work. Employer Resources (e-verify.gov)
By applying, you agree to our Privacy Policy and Terms and Conditions of Use.
#DiscoverYourPathAcosta, and its subsidiaries, is an Equal Opportunity Employer
Job Category: Retail
Position Type: Part time
Business Unit: Marketing
Salary Range: $20.00 - $20.00
Company: Mosaic Sales Solutions US Operating Co, LLC
Req ID: 27210
Employer Description: US_MOSAIC_EMP_DESC

100% remote worknj
Title: Vascular Therapy Development Specialist - New Jersey
Location: State of New Jersey, United States of America
Job Description:
At Medtronic you can begin a life-long career of exploration and innovation, while helping champion healthcare access and equity for all. You’ll lead with purpose, breaking down barriers to innovation in a more connected, compassionate world.
A Day in the Life
We are seeking a committed professional to join our team. While this is a remote position not located at a physical Medtronic site, the candidate hired will be required to reside within the territory and drive to multiple accounts throughout the region. A valid driver's license is essential for this role.
The role requires availability to work evenings, weekends, and holidays as
determined by local management and domestic travel of more than 70%.Position Description
The Therapy Development Specialist (TDS) provides advanced clinical and technical support for new PVH vascular therapies and products across erse clinical settings. Partnering with Therapy Development Representatives (TDR), the TDS supports critical cases and applies strong clinical expertise to ensure safe and effective use of new technologies. The role trains, supports, and educates physicians on PVH carotid and thrombectomy therapies and serves as a clinical subject matter expert within the Vascular Sales organization. The role reports to the Area Therapy Manager.
Position Responsibilities
Clinical & Technical Support:
Provide advanced clinical expertise and hands-on procedural support for new vascular technologies.
Deliver urgent and high-priority case coverage for PVH carotid, thrombectomy, and new vascular therapies.
Support adoption and utilization of new technologies through best practices, training, and technical guidance.
Assess customer needs and address objections to maximize value of vascular solutions.
Sales Support & Commercial Execution:
Partner with TDRs and vascular field teams to optimize case support and business execution.
Support market development and new account launch strategies.
Drive growth, utilization, and reorder activity—especially in new accounts.
Provide clinical insight to support account strategy and competitive positioning.
Educational Support:
Educate and train physicians, nurses, and clinical staff through in-services and presentations.
Deliver ongoing education and technical support for new products.
Conduct hospital and clinic visits to support sales and service objectives.
Lead and support training events and product demonstrations.
Customer Focus and Relationship Management:
Build and maintain relationships with clinicians, administrators, and staff.
Drive physician adoption through sustained education and case support.
Gather feedback on new products and communicate insights to leadership.
Ensure compliance with consignment, inventory, and credentialing requirements.
After Hours & Travel Requirements:
Provide after-hours case support including weeknights and weekends as needed.
Travel within assigned territory ≥70% of the time; overnight travel may be required.
Basic Qualifications:
High School Diploma with 8+ years relevant experience OR
Associate’s Degree with 6+ years relevant experience OR
Bachelor’s Degree with 4+ years relevant experience
Preferred Qualifications:
Clinical Specialist expertise in carotid, embolic, and/or thrombectomy therapies
Experience supporting new therapy adoption and driving utilization growth
Strong medical device and vascular knowledge
Excellent communication, organization, and project management skills
Proficiency in Microsoft Outlook, Excel, Word, and PowerPoint
For Baccalaureate degrees earned outside of the United States, a degree that satisfies the requirements of 8 C.F.R. § 214.2(h)(4)(iii)(A) is required.
Physical Job Requirements
The above statements are intended to describe the general nature and level of work being performed by employees assigned to this position, but they are not an exhaustive list of all the required responsibilities and skills of this position.
The physical demands described within the Responsibilities section of this job description are representative of those that must be met by an employee to successfully perform the essential functions of this job. Reasonable accommodations may be made to enable iniduals with disabilities to perform the essential functions. For Office Roles: While performing the duties of this job, the employee is regularly required to be independently mobile. The employee is also required to interact with a computer, and communicate with peers and co-workers. Contact your manager or local HR to understand the Work Conditions and Physical requirements that may be specific to each role.
U.S. Work Authorization & Sponsorship
At Medtronic, we are committed to fostering an environment where employees can thrive and make a meaningful impact. In alignment with our enterprise-wide workforce planning approach, U.S. work authorization sponsorship (H-1B, TN, J, etc.) is offered exclusively for Principal-level roles and above, where specialized expertise aligns with long-term business needs. Roles below the Principal level require candidates to possess unrestricted U.S. work authorization at the time of hire and for the duration of employment.
Join us in our mission to alleviate pain, restore health, and extend life—where your unique background and perspective are valued.
Benefits & Compensation
Medtronic offers a competitive Salary and flexible Benefits Package
A commitment to our employees lives at the core of our values. We recognize their contributions. They share in the success they help to create.We offer a wide range of benefits, resources, and competitive compensation plans designed to support you at every career and life stage.Salary ranges for U.S (excl. PR) locations (USD):$110,000 - $120,000
In addition to Base Salary, this position is eligible for a Sales Incentive Plan (SIP), which provides the opportunity to earn significant incentive compensation for achieving or exceeding your goals.
The following benefits and additional compensation are available to those regular employees who work 20+ hours per week: Health, Dental and vision insurance,Health Savings Account,Healthcare Flexible Spending Account,Life insurance, Long-term disability leave,Dependent daycare spending account,Tuition assistance/reimbursement, andSimple Steps (global well-being program).
The following benefits and additional compensation are available to all regular employees:Incentive plans, 401(k) plan plus employer contribution and match,Short-term disability,Paid time off,Paid holidays,Employee Stock Purchase Plan,Employee Assistance Program,Non-qualified Retirement Plan Supplement (subject to IRS earning minimums), andCapital Accumulation Plan (available to Vice Presidents and above, or subject to IRS earning minimums).
Regular employees are those who are not temporary, such as interns. Temporary employees are eligible for paid sick time, as required under applicable state law, and the Employee Stock Purchase Plan. Please note some of the above benefits may not apply to workers in Puerto Rico.
About Medtronic
We lead global healthcare technology and boldly attack the most challenging health problems facing humanity by searching out and finding solutions.
Our Mission — to alleviate pain, restore health, and extend life — unites a global team of 95,000+ passionate people. We are engineers at heart— putting ambitious ideas to work to generate real solutions for real people. From the R&D lab, to the factory floor, to the conference room, every one of us experiments, creates, builds, improves and solves. We have the talent, erse perspectives, and guts to engineer the extraordinary.It is the policy of Medtronic to provide equal employment opportunity (EEO) to all persons regardless of age, color, national origin, citizenship status, physical or mental disability, race, religion, creed, gender, sex, sexual orientation, gender identity and/or expression, genetic information, marital status, status with regard to public assistance, veteran status, or any other characteristic protected by federal, state or local law. In addition, Medtronic will provide reasonable accommodations for qualified iniduals with disabilities.
If you are applying to perform work for Medtronic, Inc. (“Medtronic”) in any position which will involve performing at least two (2) hours of work on average each week within the unincorporated areas of Los Angeles County, you can find here a list of all material job duties of the specific job position which Medtronic reasonably believes that criminal history may have a direct, adverse and negative relationship potentially resulting in the withdrawal of a conditional offer of employment. Medtronic will consider for employment qualified job applicants with arrest or conviction records in accordance with the Los Angeles County Fair Chance Ordinance for Employers and the California Fair Chance Act.

enghybrid remote workoxfordunited kingdom
Admission - Senior Admission Counselor
Location: Oxford
remote type
Hybrid
locations
Oxford Campus
time type
Full time
Job Description:
Job Title
Admission/Senior Admission Counselor
Department
Admissions Campus Visits
Worker Type
Regular
Pay Type
Salary
Position Salary Minimum
$45,000 (Admission Counselor)
$47,000 (Sr Admission Counselor)Position Salary Maximum
$48,000 (Admission Counselor)
$50,000 (Sr Admission Counselor)Salary will be commensurate with the level of the position, education, and experience.
Scheduled Weekly Hours
40
Benefit Eligible
Yes
Screening Date
2026-04-27
Job Description Summary
Miami University’s Office of Admission seeks an energetic, creative, and collaborative inidual to serve as an admission counselor for first-year recruitment. In partnership with admission team members, the admission counselor will play an integral role in meeting enrollment goals and assume the management of a first-year recruitment territory to include 6-8 weeks of travel, application review, and relationship management.
In addition to assigned territory management and collaboration on admission events and programs, this position will assist with the recruitment of underrepresented and international students. The admission counselor will assist with and coordinate on- and off-campus visits and events, including high school counselor and pre-college programs (Bridges, Summer Scholars), and manage Miami’s group visit program.
This position is eligible for work on a hybrid basis. Remote/hybrid work is not a right, but a working arrangement that can be modified or revoked by Miami University at any time for any reason.
Job Description
Essential Duties
Knowledge of University & Brand Representation: Develop working knowledge of Miami University programs, opportunities, and policies and communicate information about the Miami brand, experience, and outcomes and its admission policies and procedures to prospective students, families, and other key influencers. Represent Miami at on- and off-campus student recruitment and yield events and campaigns. Present to audiences ranging from 20 to over 300 participants. (20%)
Student-Centered Support: Provide exceptional customer service and personalized guidance to prospective students and their families throughout the admission process, embodying Miami's Code of Love and Honor through extraordinary hospitality and transparency. Correspond with students and their families, including the use of email, phone calls, and zoom meetings, provide presentations, and routinely fulfill counselor-on-duty responsibilities. Build and maintain relationships with school counselors within assigned territory. (20%)
Territory Management: Manage a recruitment territory, which includes planning and conducting 8 to 12 weeks of recruitment travel, maintaining counselor relations, following up with students and families, and monitoring enrollment trends, making needed adjustments to meet enrollment goals. Continuously monitor and evaluate enrollment trends in territory. Utilize the CRM, data, industry best practices, and other forms of quantitative and qualitative feedback to inform decisions, identify areas of concern and opportunity, (20%)
Application Review & Decision-Making: Participate in assigned electronic file review for undergraduate domestic and international first-year admission, Honors programs, and pre-college programs, adhering to all review deadlines. Conduct contextual and holistic review of undergraduate, first-year applications, recommending admission decisions in accordance with Miami University's admission policies, values, priorities, and deadlines. (20%)
Organize, coordinate, and manage on- and off-campus recruitment events, high school counselor programs, and high-ability programming. (10%)
Other duties as assigned. (10%)
Minimum Qualifications
Admission Counselor:
Bachelor's Degree (must be obtained by start date)
Senior Admission Counselor:
Bachelor's Degree and two or more years of recruitment cycle or experience in Admission or a Master's degree and one year of experience.
The experience may be obtained during degree completion.
Admission Counselor/Senior Admission Counselor:
Must be able to work some evenings, perform overnight and some weekend travel, transport 30-40 lbs. of recruiting materials, and possess a valid driver’s license.
Required Knowledge Skills and Abilities
Knowledge of and experience with computer systems and various software applications, including Microsoft Word, Excel, and PowerPointIdeal candidates will be politically savvy and diplomatic, demonstrate a proven positive work ethic and attitude, possess exceptional written and oral communication skills, dynamic group presentation skills, and proven commitment and ability to work with erse constituencies.
Must be able to work independently and as a team member, and handle multiple tasks simultaneously with a high attention to detail.
PREFERRED QUALIFICATIONS:
Master's Degree1-2 years of experience in higher education, recruitment, marketing, or other related field
Experience with customer relations database (Slate)
Experience working with school counselors, community-based organizations, alumni volunteers
Event planning experience
Data analysis experience
Additional Position Information (if applicable)
Required Application Documents
resume and cover letter
Special Instructions (if applicable)
none
Additional Information
A criminal background check is required. All campuses are smoke- and tobacco-free campuses.
This organization participates in E-Verify.
Remote Work
For positions that are approved for remote work: Remote work is not a right, it is a work arrangement that can be modified or revoked by Miami University at any time for any reason, including the convenience of the University.Reasonable Accommodations
Requests for reasonable accommodations for disabilities related to employment should be directed to [email protected] or 513-529-3560. Questions and follow-ups regarding requests should also be directed here.Miami University Values Statement
Miami University is a scholarly community whose members believe that a liberal education is grounded in qualities of character as well as of intellect. We respect the dignity of other persons, the rights and property of others, and the right of others to hold and express disparate beliefs. We believe in honesty, integrity, and the importance of moral conduct. We defend the freedom of inquiry that is the heart of learning and combine that freedom with the exercise of judgment and the acceptance of personal responsibility.For more information on Miami University’s mission and core values, please visit the Mission and Core Values webpage.
Equal Opportunity/Affirmative Action Statement
Miami University, an Equal Opportunity/Affirmative Action employer, encourages applications from protected veterans and iniduals with disabilities. Miami University prohibits harassment, discrimination and retaliation on the basis of age (40 years or older), color, disability, gender identity or expression, genetic information, military status, national origin (ancestry), pregnancy, race, religion, sex/gender, status as a parent or foster parent, sexual orientation, or protected veteran status in its application and admission processes, educational programs and activities, facilities, programs or employment practices. Requests for reasonable accommodations for disabilities related to employment should be directed to [email protected] or 513-529-3560.Clery Act
As part of the University’s commitment to maintaining a healthy and safe living, learning, and working environment, we encourage you to read Miami University’s Annual Security & Fire Safety Report at: http://www.MiamiOH.edu/campus-safety/annual-report/index.html, which contains information about campus safety, crime statistics, and our drug and alcohol abuse and prevention program designed to prevent the unlawful possession, use, and distribution of drugs and alcohol on campus and at university events and activities. This report also contains information on programs and policies designed to prevent and address sexual violence, domestic violence, dating violence, and stalking. Each year, email notification of this website is made to all faculty, staff, and enrolled students. Written notification is also provided to prospective students and employees. Hard copies of the Annual Security & Fire Safety Report may be obtained from the Miami University Police Department at 513-529-2223.Labor Law Posters for Applicants
Please visit our Labor Law Posters webpage to access all relevant and applicable labor law information.

100% remote workus national
Title: Manager, PCGS Customer Experience
Location: US - Remote
time type
Full time
job requisition id
JR104834
Collectors is the leading creator of innovative technology that provides value-added services for collectors worldwide. We grade, authenticate, vault, and sell millions of record-setting collectibles, all while modernizing and digitalizing the process to further our mission of helping collectors pursue their passions. We’re always on the lookout for talented people to join our growing team.
Our services span collectible trading cards, autographs, comic books, coins, video games, event tickets, and memorabilia. Our subsidiaries include PSA, PCGS, Beckett, SGC, and Card Ladder.
Since our founding in 1986, we have graded and authenticated millions of items. We employ more than 3000 people across our headquarters in Santa Ana, California and offices in New Jersey, Texas, Florida, Japan, Shanghai, Hong Kong, Canada, Mexico, Germany, and France.
As part of our interview process, we request that candidates have their cameras on during video interviews. This helps foster meaningful conversation and allows us to create an experience that closely resembles our standard working environment. Certain interview steps may take place by phone. For remote roles, and at our discretion, candidates may be asked to participate in an on-site interview as part of the final stages of the process.
We understand there may be occasional circumstances requiring accommodation and are happy to discuss them as needed. Your recruiter will be able to clarify expectations and answer any questions you have.
We are currently looking for a Manager, Customer Experience to lead the strategy and execution of all customer-facing service operations and event experiences for PCGS. You will oversee Customer Care and Events, ensuring collectors, dealers, and partners receive best-in-class support across every interaction with the brand. You will lead a team responsible for managing customer inquiries, order issue resolution, call center operations, and PCGS’s presence at major industry events and trade shows. This role will focus on delivering operational excellence, improving service processes, and creating exceptional experiences that strengthen customer trust and loyalty.
This role reports to the PCGS President and will be based onsite at our Santa Ana, CA headquarters with occasional domestic and international travel as needed. Remote or hybrid candidates will also be considered. We believe that there is significant value in in-person collaboration. If you live within a 1 hour commuting distance to one of our offices, you will be required to be onsite most of the time. This will be discussed further as part of the recruiting process.
What You’ll Do:
Lead PCGS Customer Care Operations: Oversee all customer service functions including call center operations, inbound inquiries, order issue resolution, and dealer support. Ensure consistent, high-quality service across all customer touchpoints.
Manage a High-Performing Customer Experience Team: Lead, mentor, and develop a team of customer care and event professionals. Establish clear performance standards, service metrics, and accountability across the organization.
Improve Customer Service Processes: Identify opportunities to streamline workflows, reduce response times, and improve the efficiency and effectiveness of support operations through process improvements and technology adoption.
Oversee PCGS Event Strategy and Execution: Manage the staffing, planning and execution of PCGS’s presence at domestic coin shows, trade and grades and drop-off events. Ensure events deliver strong customer engagement, operational efficiency, and high submission volumes.
Enhance the Collector and Dealer Experience: Continuously improve how collectors and dealers interact with PCGS, protecting the brand while ensuring every interaction—from inquiries to submissions to events—reflects the company’s commitment to service excellence.
Partner Cross-Functionally: Work closely with operations, marketing, product, sales, and finance teams to resolve customer issues, improve communication, and align service initiatives with broader business goals.
Develop Customer Experience Metrics: Establish and monitor key performance indicators such as service levels, response times, resolution rates, and customer satisfaction to ensure continuous improvement.
Escalation & Issue Management: Serve as the senior leader responsible for resolving complex customer issues, ensuring high-value clients and key dealers receive thoughtful and timely support.
Drive Continuous Improvement: Implement best practices for customer service operations, call center management, and event execution to scale the organization as PCGS continues to grow.
Who You Are:
Customer Experience Leader: You bring 8+ years of experience leading customer service, customer experience, or operations teams, ideally in a high-volume service environment.
Operationally Strong: You are comfortable managing complex workflows and large teams while maintaining a focus on service quality and efficiency.
Customer-First Mindset: You deeply understand the importance of trust and responsiveness in customer relationships and consistently advocate for the customer experience.
Show & Event Familiarity: You understand how trade shows and industry events operate and can design experiences that engage customers and drive submissions.
Strong Communicator: You communicate clearly and effectively with collectors, dealers, internal teams, and leadership.
Problem Solver: You thrive in dynamic environments and enjoy tackling complex customer issues with thoughtful, practical solutions.
Team Builder: You develop strong teams, set clear expectations, and create a culture focused on service, accountability, and continuous improvement.
Adaptable and Growth-Oriented: You are comfortable building new processes, improving systems, and scaling operations as the business evolves.
Preferred Qualifications:
Experience in the collectibles, auction, or grading industries.
Experience managing call center or customer service operations at scale.
Prior responsibility for customer experience metrics such as NPS, CSAT, or service-level performance.
Experience leading teams across multiple locations.
Travel Requirements:
Willingness and ability to travel approximately 25–30% of the time for coin shows, customer meetings, and internal collaboration domestically.
Salary Range:
The salary range for this position is $94,779 - $153,876. Actual compensation on this range varies based on a variety of non-discriminatory factors, including location, job level, experience, and skill set. This role may be eligible for bonuses, commissions, or other forms of compensation, please ask your recruiter for details.
Reasons To Join Us:
Health Insurance: All full-time employees are eligible to enroll in Medical, Dental, and Vision
Additional Benefits: Full-time employees are eligible for fertility, commuter, and educational assistance benefits
401(K) Matching Plan: We are proud to offer a competitive 401k matching plan to our employees to support their future financial goals
Vacation: All salaried employees are eligible for flexible time-off
Holiday Pay: All regular, full-time employees are eligible for ten company paid holidays
Employee Discounts: Employees receive discounts on select grading services for approved submissions
Flexible Hours: Many of our teams offer flexible schedules with varying shifts and will work with you to accommodate your needs
Fun Working Environment: Our team members are invited to participate in celebrations, holiday events, and team building activities
Candidates must be authorized to work in the United States.
Collectors uses e-Verify to validate your ability to work legally in the United States.
We are aware that there are instances where iniduals are receiving job offers that fraudulently allege to be from Collectors or one of our business units. This type of fraud can be carried out through false websites, through fake e-mails claiming to be from the company or through social media. We never ask for personal information such as your bank account, Social Security numbers or National IDs, nor do we send or request payments for the purchase of business-related equipment. If you suspect fraud,
We are committed to equal employment opportunity regardless of race, color, ethnicity, ancestry, religion, national origin, gender, sex, gender identity or expression, sexual orientation, age, citizenship, marital or parental status, disability, veteran status, or other class protected by applicable law. We believe that a team that represents a variety of backgrounds, perspectives, and skills will better service the erse community of collectors we support.
U.S. residents: for disclosures relating to personal information we collect during the employment application and recruitment process, please see our Privacy Notice for U.S. Applicants.

buffalohybrid remote workny
Title: Prior Authorization Coordinator
Location: Buffalo, NY
Job Description:
Full time
job requisition id
R0012356
FIND YOUR FUTURE
We're excited about the potential people bring to our organization. You can grow your career here while enjoying first-class perks, benefits and a culture that fosters growth, innovation and collaboration.
Overview
The Prior Authorization Coordinator will facilitate the logging in and out of all prior authorization, appeal, reimbursement and grievance requests, and follow-up on requests to ensure that all are resolved and completed in a timely manner. The coordinator will ensure that all steps involved with the process are completed and all regulatory requirements are met or exceeded. They will also be responsible for the pharmacy medical exception line to address provider questions regarding the formularies for all lines of business serviced by Pharmacy Benefit Dimensions.
The coordinator will also be assigned to provide high quality, erse administrative support including but not limited to faxing prior authorization requests, completing decision letters by faxing and copying, making decision notification phone calls to members and physicians, filing, and document scanning preparation. Occasional holidays, weekends and overtime will be a requirement of the position.
Qualifications
- High school diploma or GED required. Associates degree preferred.
- Two (2) years of experience in pharmacy or health insurance operations required OR one (1) year of experience as a temporary associate in the Prior Authorization Coordinator role or Prior Authorization department required. Pharmacy experience strongly preferred.
- General knowledge of drug names, therapeutic categories, dosage forms, manufacturers and packaging preferred. Familiarity with HMO concept.
- Experience with pharmacy on-line system preferred.
- Written and verbal communication skills.
- Excellent organizational and time management skills.
- Excellent ability to absorb new concepts and adapt to a changing environment.
- Exhibit creativity and self-motivation, with the ability to effectively solve problems as they arise.
- Demonstration of math aptitude for purposes of calculating simple drug requirements when given dose and price calculations.
- Proven examples of displaying the PBD values: Trusted Advisor, Innovative, Excellence, Guardianship, Dedication and Caring.
Essential Accountabilities
- Assist Clinical Review Pharmacist in making appropriate decisions by verifying member and provider eligibility and filing requests into the correct member folder according to set standards.
- Enter data and ensure complete accuracy on all statistics by logging prior authorization requests into pharmacy systems according to set standards.
- Complete the requests by entering override into the appropriate pharmacy system and updating all information in required documentation systems according to set standards. May also include transcribing Medical Director decision into systems.
- As volume dictates, timely and accurately complete various reports, reimbursement requests, IRO and review of vendor emails/reports as assigned by the Supervisor.
- Facilitate follow-up phone calls to members and providers for clinical approvals and denials according to set standards.
- Initiate outbound telephone calls to members/physicians regarding decisions within all regulatory time frame requirements.
- Answer and provide resolution to provider and internal callers regarding formulary/prior authorization questions for all lines of business. Log all calls into call documentation systems.
- Research and respond to escalated and complex inquiries regarding Pharmacy questions or concerns. Ensure that all callers obtain accurate and up-to-date information on policies and procedures and communicate a successful resolution to inquiries. Provide callbacks when necessary.
- Provide support for all required letters within the required timeframes.
- Fax prior authorization requests including requests for additional information and completed requests.
- Copy and mail completed requests and related documents.
- Prepare completed requests for scanning into documentation systems.
- Maintain proper storage of all files, in accordance with the corporate retention policy.
Immigration or work visa sponsorship will not be provided for this position
Hiring Compensation Range: $22.00 - $23.50 hourly
Compensation may vary based on factors including but not limited to skills, education, location and experience.
In addition to base compensation, associates may be eligible for a scorecard incentive, full range of benefits and generous paid time off. The base salary range is subject to change and may be modified in the future.
As an Equal Opportunity / Affirmative Action Employer, Independent Health and its affiliates will not discriminate in its employment practices due to an applicant’s race, color, creed, religion, sex (including pregnancy, childbirth or related medical conditions), sexual orientation, gender identity or expression, transgender status, age, national origin, marital status, citizenship and immigration status, physical and mental disability, criminal record, genetic information, predisposition or carrier status, status with respect to receiving public assistance, domestic violence victim status, a disabled, special, recently separated, active duty wartime, campaign badge, Armed Forces service medal veteran, or any other characteristics protected under applicable law.

100% remote workus national
Title: Technical Support Tier 2
locations
USA - Remote
time type
Full time
job requisition id
JOBREQ-28401
Job Description:
At Fusion Connect, we’re not just offering jobs — we’re building careers that empower, inspire, and grow with you.
If you're passionate about making an impact, collaborating with forward-thinking teams, and being part of a company that values your voice, you’re in the right place.
We’re thrilled you’re exploring this opportunity with us — take a look, imagine the possibilities, and let’s shape the future of connectivity together.
Job Description Summary:
Fusion Connect is seeking an experienced networking and voice skilled technician to join our Technical Support Tier 2 team. Our technical teams are highly skilled employees with best practice experience in a variety of advanced products and services who enjoy overcoming challenges and working as a team. You will be collaborating with other team members to provide best-in-class customer service, every day, without exception. Our daily operational expectations include answering inbound calls, resolving complex issues, managing both internal and external escalations, and quickly resolving day-to-day operational requests. This is a customer-facing role and regular interaction with our customers is a must to achieve the best possible outcome.
Job Description:
This position may require flexibility in scheduling and on-call responsibilities to ensure escalations are addressed quickly during core and after hours.
Duties/Responsibilities:
- Provide excellent customer service, every day, without exception, by accomplishing the following daily operational goals:
- Work collaboratively within a tier 2 customer operations team to support a variety of services and equipment including Hosted Voice, SIP, SD-WAN services, professional/IT services, copper POTs services, and voice/data over multiple connection types including internet, managed circuits, LTE, and MPLS.
- Provide problem identification, resolution, and after-action reports for continued cross training and incident response improvement
- Navigate multiple CRMs and/or ticketing systems to appropriately manage and gather data
- Troubleshoot complex network environments, products, and service issues, including 3rd party: Hardware, Circuits, and Legacy Copper POTS Lines - Examples: VPN, MPLS, BGP Peering, etc.
- Expected to log into a call queue and handle customer and vendor calls with a positive problem-solving attitude
- Strive for first call resolution, if first call resolution cannot be met, properly code trouble tickets for follow up and when necessary, escalation to Tier III Tech Support using Ticket classification Guidelines
- Properly document in OSS system call purpose and resolution
- Utilize online resources and internal knowledge base software such as “ProcedureFlow” to resolve customer troubles
- Manage relationships between vendors, internal resources, and customers via phone, ticketing system/portal, email, and/or chat
- Participate in continuing education and training for new products and services
- Must follow predefined guidelines, protocols, and procedures as directed
- Consult with Tier III, lead, supervisor, or manager as needed for problem resolutions
- Be available to work any shift in a 24x7 call center environment
- Level 2 on-call responsibilities at logged hourly time for work performed
- Flexibility to perform additional tasks or duties outside of normal daily activities
- This could include participating in a Tier 1 support role, service delivery capacity or professional services support environment
Required Skills/Abilities:
- Strong analytical thinking and problem-solving skills
- Strong teamwork and communication skills
- Ability to work under pressure, and to make calculated decisions
- Ability to manage multiple tasks/priorities and act quickly in a fast-paced environment
- Scheduling flexibility
- Thrive in a remote workspace from home, including internet and dedicated workspace, and accountability for productivity
- Trustworthy work ethic and ability to work independently
- Demonstrated documentation skills for clearly communicating methods and procedures to lower tier support teams
Preferred Education and Experience:
- Bachelor’s Degree (Technical focused degree) preferred
- Three (3) years of hands-on experience in telecom, tech support, networking, or hardware, such as switches, routers, hubs, phone systems (PBX/CBX)
- Examples of hardware types: Meraki, Fortinet, Cisco, Juniper, Barracuda, Velos, etc.
- Three (3) years of changing routers experience configurations
- Three (3) years of Data networking Protocols, such as OSPF, BGP, ACL, NAT, DHCP, and Subnetting
- Three (3) years of working knowledge of TCP/IP protocols, such as SMTP, DNS, HTTP, and the like
- Three (3) years of working knowledge of VoIP

100% remote workmilwaukeewi
Title: Field Sales Specialist, Milwaukee
Location: Wisconsin
Job Description:
WHO WE ARE
We’re Talking Rain Beverage Company, we create better-for-you beverages featuring great flavors and colors from natural sources. We live life in full flavor and believe the world should too. We create connections with every sip of our iconic Sparkling Ice, Sparkling Ice Caffeine, Sparkling Ice Energy, Popwell and MIXT.
When it comes to success, we know we’re only as strong as our team. That's why we're an equal-opportunity employer. We value ersity and practice inclusivity, hiring great people who enhance our company.
Our Rain Makers are our most important asset. That’s why we invest in them with benefits and development opportunities that reflect just how much we value them.
WHAT YOU'LL DO
Drive, not ride. With a mindset of service, our Sales team goes out and executes in the market. Flawlessly. Now that’s how you build relationships.
You’ll merchandise our consumers’ favorite flavors in the Milwaukee Proper (New Berlin, WI), making it easy and enjoyable for them to reach for their favorites. This is a great chance to get your foot in the door if you’re interested in a career in sales.
Reports to: Regional Sales Manager
Direct Reports: N/A
Location: Remote work from home in Milwaukee, WI
Annual Bonus Potential: 10% - Eligibility is based on the company hitting annual financial targets.
Hourly Rate: $22.00Business miles will be reimbursed at the IRS standard mileage rate.
Stocking shelves, displays, and coolers, rotating and removing any out-of-date products.
Build displays and endcaps, extending our reach beyond the shelf to increase consumer awareness.
Organizing pallets and rotating products in storage rooms.
Provide outstanding service to retailers, responding to requests and escalating issues as needed.
Learn each retailer’s policies and practices, as well as their wants and needs for the beverage department.
Establish a professional relationship with our Sales team, as well as our distributor and retailer partners.
Keep safety in mind at all times, following proper safety practices especially when lifting, pushing, and pulling cases.
Ensure food safety, quality, and SQF practices are followed promptly, notifying the immediate manager of any food safety and/or quality issues.
Complete other responsibilities as assigned.
WHAT YOU BRING
One (1) year of front-line service experience (i.e. retail, restaurants, movie theaters)
Must have a valid driver’s license with an acceptable driving record.
Reliable personal vehicle and auto insurance that meets the state minimum requirements.
Ability to lift and carry 35 lbs. repetitively and push/pull up to 100 lbs. regularly.
This role is safety-sensitive. This means that as part of your core responsibilities, you will be regularly responsible for your own safety and/or the safety of others (e.g., driving on behalf of the company, or working in a warehouse/plant environment).
Rain Makers are people who are accountable, curious, and inclusive.
We hold ourselves accountable and recognize room for growth while openly accepting feedback. We embrace change to deliver progressive results.
Rain Makers don’t wait for answers – we go find them. Curiosity is part of what makes us so successful. Sometimes we push back, productively challenging the status quo.
We promote inclusivity. Valuing communication and respect, ensuring everyone has a seat at the table. We are an approachable bunch, building and fostering relationships with people of all backgrounds.
WHAT WE OFFER
Nothing makes a great job even better than throwing in a few perks! All regular, full-time Rain Makers are equipped with everything they need to maintain their health and well-being. That means things like...
Three Weeks of Vacation per calendar year. And that’s just to start! Spend some time with us, and you’ll accrue an additional week every few years, depending on your exempt status!
FMLA qualifying Rain Makers receive six weeks of paid parental leave. Parents get to spend time at home bonding with their new addition (whether it arrives by birth, fostering, or adoption). For birth mothers, additional time is provided for medical leave. Depending on the state in which you reside, additional time may also be available for parents who do not require medical leave.
Flexibility Stipend. For eligible Rain Makers, spend this extra monthly stipend as you wish, but know it’s intended to contribute to things like your phone, internet or other business uses while working remotely or needs outside of normal working hours.
Relocation: Relocation Available (when available)
Onsite and Hybrid Rain Makers: Get paid to carpool! Drive to work with another Rain Maker every week at least 2X a week and receive mileage reimbursement.
401k with Immediate Vesting. With matched contributions and investment customization, we'll help build a plan to reach your goals.
Fitness Reimbursements. We're all about going the extra mile, so we provide reimbursements for community events and competitions like fun runs, triathlons, and cycling tours.
- Rain Makers may also enjoy access to our on-site gym in Preston complete with a personal trainer 2 days per week.
Medical/Dental/Vision. Not only do we offer it, but our plans are excellent and flexible to your needs. And one is even free for our Rain Makers!
Vehicle Program –
Field Sales Specialist – Mileage is reimbursed at the IRS rate
Field Sales Managers and Market Managers – Company car or vehicle stipend included!
Regional Sales Managers and Sales Directors – We use the leader in vehicle reimbursement solutions, Motus. This program provides a monthly fixed and variable rate that adheres to IRS guidelines for the business use of personal vehicles.
Please note, eligibility for our full benefits package is based on an average of 30+ hours per week in regular (not temporary) positions.
Want to get to know us better? Click to learn about us and our careers. You can also follow us on LinkedIn, Glassdoor, Instagram, and Facebook.

100% remote workus national
Title: Operational Data Analyst
Location
Anywhere in the United States
Employment Type
Full time
Location Type
Remote
Department
Clinical
Compensation
$85K – $115K • Offers Equity
Nabla is committed to fair and equitable compensation practices. Salary ranges are determined through alignment with market data. Base salary offered is determined by a number of factors including the candidate’s experience, qualifications, and skills. Certain positions are also eligible for variable pay and/or equity; your recruiter will discuss the full compensation package details.
About Nabla
We are a team of entrepreneurs, clinicians and engineers committed to bringing back joy to the practice of medicine.
Together with a community of clinician innovators, we’ve harnessed the best of machine learning science to develop Nabla: the leading AI assistant that’s restoring the human connection at the heart of healthcare. By streamlining clinical documentation, Nabla is helping clinicians focus on what matters most - patient care. Today, over 100,000+ clinicians across 130+ healthcare organizations trust Nabla to support how they deliver care every day.
We’re at the start of an ambitious journey: Ambient listening, dictation, coding, and command capabilities are all converging into a proactive assistant that intuitively streamlines clinical and financial workflows.
Backed by a recent $70M Series C, we’re hiring to build the next generation of clinical AI and improve the lives of clinicians and patients everywhere.
This is a great time to join us!
The Role
We are looking for an Operational Data Analyst to turn real-world customer deployments into scalable insight. In this role, you will analyze implementation patterns, product usage, and operational workflows to identify what drives adoption, retention, and expansion across our customer base. You will partner cross-functionally with our Customer Success, Product, and Sales teams to translate data into best-practice playbooks, measurable success benchmarks, and evidence-based collateral that strengthens both our roadmap and our market narrative.
Responsibilities
Operational Analytics
Analyze customer implementation data, product usage patterns, and lifecycle metrics to identify new areas of impact and clinical value.
Build and maintain dashboards that track Go Live performance, time-to-value benchmarks, and early indicators of customer engagement.
Quantify the impact of configuration decisions, workflow design, and feature utilization on customer outcomes.
Identify trends and recurring friction points across deployments, translating them into structured insights for Operations and Product teams.
Cross-Functional Collaboration
Collaborate with Clinical Product to surface real-world deployment insights that inform roadmap prioritization and feature refinement.
Work with Sales and Customer Success to develop evidence-based narratives around product value and operational impact.
Work with the Marketing team to evaluate communication opportunities, shape messaging based on real-world product impact, and support the development of relevant content and thought leadership.
Support leadership with structured analysis to guide strategic decisions around customer segments, workflows, and growth opportunities.
Qualifications
3+ years of experience with clinical operations and business operations data.
Masters degree or higher in data science or related field (preferred).
Demonstrated track record of turning ambiguous business questions into structured analyses and actionable recommendations.
Excellent communication and writing skills, with the ability to collaborate effectively across teams.
Strong project management skills, with proven ability to manage multiple priorities simultaneously.
Analytical & Technical Skills
Strong SQL proficiency and experience working with large, structured datasets.
Experience building dashboards and reporting frameworks (e.g., Looker, Mode, Tableau, Sigma, etc.).
Ability to design metrics that connect operational inputs to business outcomes (e.g., time-to-value → retention → expansion).
Benefits
Just like we’re dedicated to supporting doctors’ well-being, ensuring yours is a top priority. We firmly believe that by prioritizing your well-being, we support you to excel in your work.
Here are the benefits you get when joining Nabla:
Compensation and Equity: Competitive salary and stock options
Comprehensive Health Plans: 100% inidual coverage for Medical, Dental, and Vision insurance
Time Off: Unlimited paid time off and 11 national holidays
Health Comes First: Unlimited sick leave
Parental Leave: Paid leave for new parents
Remote-friendly: $1,500 to purchase home office equipment
Trust & accountability: Full ownership of your time and schedule
Life at Nabla
When you become a part of our company, you join a team of excellence-driven, curious, and genuinely kind iniduals. Together, we're committed to making clinicians' lives easier and improving healthcare experiences for everyone. We believe in a world where clinicians can focus on what they were trained to do - caring for their patients, and where no patient feels their visit was rushed.
We come to work excited to leverage AI to do more for clinicians. We’re obsessed with our users’ satisfaction and we actively seek out opportunities to engage one-on-one with clinicians to understand how Nabla can better help. We consistently look for ways to improve and do not shy away from doing the work to excel. Whether it’s a feature our users asked for, or a new article for our blog, we prioritize collaboration to deliver exceptional outcomes.
We love having fun as much as we love work. Our #nablabla channel is as active as our #feature-show-off channel, we exercise during the work day at least 3 times a week (yoga, running, pilates, or HIIT, your choice!), enjoy regular off-sites to gather the team, and travel to see each other in places like NY, Paris, San Francisco, and many other vibrant cities. Oh, and we’re constantly snacking on chocolate or nuts!
If this sounds like an environment you’ll thrive in, we look forward to reading your application!
Our Values at Nabla
Joining Nabla means being part of a team that shares a commitment to excellence, humility, growth, and inclusion.
Every day is a new chance to excel
We aim for nothing less than the best and are willing to put in the effort and dedication required to exceed standards. We learn from yesterday’s failures and do better every day.
Stay humble
There’s no place for ego in our team. Our collective success is more important than inidual achievements. We see humility as wisdom — keeping focus on the bigger picture.
Feedback is a gift
We embrace feedback and foster a culture of trust and respect that helps everyone grow. We communicate openly about both achievements and challenges, and we actively involve each other in finding solutions.
Committed to ersity
We recognize the ongoing challenge of ersity in tech. Our responsibility starts with fostering an inclusive environment where everyone feels empowered to be their authentic selves and do their best work.
Diversity & Inclusion
Diversity and inclusivity are fundamental values at Nabla. We embrace iniduals from various backgrounds, including race, gender, educational history, sexual orientation, and beyond.
As an equal opportunity employer, we actively seek out and welcome applicants from erse backgrounds, believing that a wide range of perspectives enriches our team and enhances our ability to innovate and thrive.
Avoid recruitment scams: Stay safe and informed
There is an active employment scam which is now using Nabla to collect personal information or financial scams. If you’re contacted by a Nabla recruiter, please ensure whomever is contacting you truly represents Nabla and is utilizing a nabla.com email address. We will never ask for the exchange of any money or credit card details during the recruitment process. Nabla utilizes a hiring platform for all applications; please be aware of any suspicious email activity from people who could be pretending to be recruiters or senior professionals at Nabla.

full-timeremotetechnical support
Chainlink Labs is looking to hire a Blockchain Support Analyst - EMEA to join their team. This is a full-time position that is 100% remote with no geographical restrictions. Work remotely from anywhere.

100% remote workus national
Title: Solutions Engineer
Location: United States
Sales
Full-time
Job Description:
About Birdeye
Birdeye is the leading agentic marketing platform for multi-location brands.
Companies like H&R Block, Aspen Dental, and Caesars Entertainment use Birdeye to manage marketing across thousands of locations — from how they get found, to how they convert, to how they retain customers. Our platform replaces disconnected point tools with AI agents that execute work at the location level — responding to reviews, updating listings, publishing content, and driving conversions.
Backed by Marc Benioff, Jerry Yang, and Accel-KKR, Birdeye was named to G2’s 2026 Best Agentic AI Products list — appearing alongside the world’s leading AI companies. We’re expanding rapidly into enterprise, with growing adoption across large, multi-location brands.
What You’ll Do:
Birdeye’s team is growing! Birdeye, a next-generation reputation management platform that reimagines how customer feedback is used to acquire and retain connected customers, is looking for a rockstar Solution Engineer to work remotely in the US. If you possess the right energy, competitive spirit, personal drive and the will to win, this is an opportunity that you cannot afford to miss.
The Solution Engineer’s primary responsibility is to partner with the Sales Team to uncover and understand customer requirements and propose solutions using Birdeye’s reputation management platform. Daily activities include hosting product demonstrations for potential Birdeye customers, understanding customer requirements, demonstrating Birdeye as a solution for customer needs, collaborating on product development, and articulating customer solutions to the Customer Success team when prospects become customers. Here is what you will do:
Responsibilities:
- Be a key and active participant in client demos and presentations for upmarket and channel partner deals.
- Articulate Birdeye’s technology and product updates to prospective customers to fit their business model
- Manage the technology evaluation stage of the sales process, working in conjunction with the sales team as the key technical advisor and advocate for Birdeye products and services
- Work interdepartmentally with product, implementation and sales to craft product value propositions
- Develop a basic understanding of the competitive market landscape and identify key areas of competitive difference in assigned areas
- Answer technical questions from clients regarding Birdeye technology, features and solutions
- Establish and maintain strong relationships throughout the sales cycle with prospects
- Prepare proposals/presentations for customer meetings, as needed
- Demonstrate Birdeye’s products and services to prospects on site, remotely via webinar sessions, as needed
requirements
- Proficient using a SaaS solution for online demonstrations
- Previous industry experience with API’s
- Technical appetite to become a Birdeye expert
- SaaS technology background
- Strong understanding of sales, marketing and SaaS solution selling
- Experience in leading product demonstrations and online sales meetings
- Excellent communication skills required
- Ability to quickly understand customer needs and communicate a solution
- Demonstrated ability to work in an online sales environment
- Previous employment working for a SaaS company preferred
- Ability to analyze data with excellent attention to detail
- Demonstrated ability to meet deadlines and juggle multiple priorities
Nice to have
- Previous experience working in sales overlay / sales support preferred
- Technical curiosity and a desire to fully explore the technology at hand is a big plus
- Salesforce.com experience preferred
- Excellent Microsoft Office Suite proficiency
- Excellent written, phone, video chat, and communication skills
- Well-organized, attentive to details, and possess clear communication and relationship skills
- A team player capable of high performance and flexibility working in a dynamic environment
- Ability to quickly understand business requirements and expectations; detail oriented
- BA/BS or equivalent work experience required
- Basic ability to handle discussions around HTML, JavaScript, and CSS, hosting, SEO and other marketing related technical topics
- Previous SaaS support experience a plus
Why You'll Join Us:
At Birdeye, we are relentless innovators driven by a singular goal: to lead our category with unparalleled excellence. We don't just set goals – we surpass them. We're a team of doers who roll up our sleeves and get the job done, delivering on our promises with unwavering dedication.
Working here means embracing a culture of action and accountability, where every person is empowered to make an impact. We don't just talk about making a difference – we make it happen.
Benefits:
- 100% Employer-paid benefits with multiple health plan options (HSA, PPO) for employees
- Unlimited PTO
- 401(k) with company match
- Flexible work from home options available
- Maternity & Paternity Leave
- Employee Resource Groups - network with like-minded "Birds"
- Abundant opportunities that come with a dynamic and fast-growing organization!

100% remote worklas vegasnv
Title: Title: Remote Inbound Travel Sales Representative
Location: Las Vegas United States
Job Description:
We Put the World on Vacation
Travel + Leisure Co. is the world's leading vacation ownership and travel membership company, with a dynamic and growing portfolio of resort, travel club, and lifestyle travel brands. Our dedicated associates help the company achieve its mission to put the world on vacation. Innovation and growth keep our work interesting and fun. Every day is a chance to learn something new and turn vacation inspiration into exceptional experiences for millions of travelers worldwide.
This is a fully virtual work from home sales position for candidates who reside in the state of Nevada only. Candidates who reside outside of this state will not be considered. Successful candidates must be able to meet our work at home requirements (see below).
How You'll Shine:
Are you passionate about travel and skilled in sales? Join our team as a Travel Sales Representative with Travel + Leisure! In this role, you'll combine your love for customer service with your sales expertise to create unforgettable travel experiences for our clients. Here's what you'll do:
Sales and Customer Service: Take inbound calls from excited customers ready to plan their dream vacations. Your expertise will guide them through the booking process for car rentals, airfare, hotel reservations, cruises and local experiences.
Subject Matter Expertise: As a Travel Sales Representative, you'll be the go-to resource for our customers. Build rapport and recommend personalized, lifestyle-aligned travel solutions-air, hotel, cruise, car, and local experiences-curated for each customer.
$16.50 per hour plus monthly sales incentives based off your performance
Start Date: Friday June 6th
What You'll Bring:
Proven Sales Experience: Demonstrated success in driving results through inbound service, outbound follow-up, and relationship-based selling.
Exceptional Interpersonal Skills: Quickly establish rapport with customers, engage in meaningful conversations, and create lasting connections. You'll ask probing questions to understand their travel needs and seamlessly offer additional services.
Strong Multitasking Abilities: Thrive under pressure and handle multiple tasks effectively.
Education Requirement: High School Diploma or GED is required.
Customer Service and Sales Experience: Six months of experience in both areas.
Travel Experience Preferred: Six months of travel-related experience is a plus.
Technology Agility: Comfortable managing several technology applications simultaneously (CRM, booking tools, payment systems, communication apps). Prior travel software knowledge (e.g., Amadeus, Apollo, Sabre, Worldspan) is helpful but not required; ability to learn quickly is essential.
Training Schedule: A 5-week training schedule from 8:00 am to 5:00 pm PST.
Post-Training Availability: Be available to work between 5:00 am and 5:00 pm PST Monday to Friday, Saturday 6:30 am to 3:00 pm PST with a set schedule provided.
Holiday Availability: Ability to work some holidays.
What is required for me to work from home?
Quiet workplace free of distractions and background noise
High speed internet requirements Download speed of 20 mbps and upload speed of 3 mbps average ping below 100m
Must be able to hardwire computer directly to a router
Must have own personal device with a working camera to be used for the first week of training (until our computers reach your home)
Intermediate computer proficiency and ability to troubleshoot technical issues while at home
How You'll Be Rewarded:
We offer a erse range of comprehensive health and welfare benefits to associates who work 30 or more hours per week to meet your needs and support you throughout your career with us. Travel + Leisure Co. benefits include:
Note: Temporary and/or seasonal associates are ineligible for Paid Time Off.
- Medical
- Dental
- Vision
- Flexible spending accounts
- Life and accident coverage
- Disability
- Depending on position, paid time off, parental leave and holidays (speak to your recruiter for additional information)
- Wish day paid time to volunteer at an approved organization of your choice
- 401k with employer match (subject to eligibility requirements, including tenure - speak to your recruiter for additional information)
- Legal and identify theft plan
- Voluntary income protection benefits
- Wellness program (subject to provider availability)
- Employee Assistance Program
Where Memories Start with You
Hospitality is at the heart of all we do at Travel + Leisure Co. Here, you'll find an inclusive environment where we deliver excellence and take time to have fun, celebrate together, and support one another. We're always looking ahead to what's next and how we can strengthen our business, its neighboring communities, and the customer experience. Join our global team and build a career where memories start with you.
We are an equal opportunity employer, and all applications will be considered for employment without attention to their membership in any protected class. If you require any reasonable accommodation to complete your application or any part of the recruiting process, please email your request to [email protected], including the title and location of the position for which you are applying.

100% remote workminneapolismn
Title: Solutions Consultant 2
Location: Minneapolis United States
Job Description:
time type
Full time
job requisition id
JR-016978
Our Mission
At Palo Alto Networks®, we’re united by a shared mission—to protect our digital way of life. We thrive at the intersection of innovation and impact, solving real-world problems with cutting-edge technology and bold thinking. Here, everyone has a voice, and every idea counts. If you’re ready to do the most meaningful work of your career alongside people who are just as passionate as you are, you’re in the right place.
Who We Are
In order to be the cybersecurity partner of choice, we must trailblaze the path and shape the future of our industry. This is something our employees work at each day and is defined by our values: Disruption, Collaboration, Execution, Integrity, and Inclusion. We weave AI into the fabric of everything we do and use it to augment the impact every inidual can have. If you are passionate about solving real-world problems and ideating beside the best and the brightest, we invite you to join us!
This role is remote, but distance is no barrier to impact. Our hybrid teams collaborate across geographies to solve big problems, stay close to our customers, and grow together. You will be part of a culture that values trust, accountability, and shared success where your work truly matters.
Job Summary
Your Career
The Solutions Consultant is the evolution of the traditional Sales Engineering role, aligning howwe best serve our customers in understanding their environment, providing solution guidanceand ensuring value realization in their investment with Palo Alto Networks. As a SolutionsConsultant you provide technical leadership and expertise and guidance in your customer’ssecurity transformation journey. You will play a key role in defining technical solutions thatsecure a customer’s key business imperatives and ensuring value realization of their investmentwith Palo Alto Networks. You evangelize our industry leadership in on-prem, cloud, and securityoperations services that establish PANW as your customer’s cybersecurity partner of choice.Your Impact
Curiosity is core to the Solutions Consultant role, and you see complex problems asopportunities to learn and deliver innovative solutions! You define your impact by:Meeting and exceeding sales quotas by building and implementing strategic, technical account plans that target cross-platform solutions.
Understands Key customer business requirements and has the ability to position, demonstrate and create high level designs across the entire PANW portfolio solutions creating business value for customers.
Ability to drive customer adoption of Palo Alto Networks Platform. Building customer relationships by helping customers achieve increased productivity, operational efficiency, security efficacy, and greater flexibility to innovate.
Conducting discovery to understand and articulate the key technical, operational, and commercial imperatives of your prospects and customers
Working closely with Professional Services, Customer Success and Specialist teams to ensure overall customer implementation and adoption of solutions.
Demonstrating strong communication skills, influencing through effective presentations and customer-specific demos, and conducts technical engagements and workshops that are clear and impactful, simplifying complex ideas for various audiences
Leading successful technical validation efforts based on best practices to ensure technical win in assigned opportunities.
Demonstrates Cross functional leadership driving collaboration and orchestrating supporting resources (Specialists, Channel Resources, Customer Support) to ensure a one-team approach that demonstrates a cohesive strategy.
Promoting end-to-end solutions that include PANW and/or partner professional services to ensure customers realize business value sooner
Understanding the competitive landscape and effectively differentiating PANW's leadership in the cybersecurity space
Continuously investing in yourself to develop technical and professional skills that drive your ever-increasing contributions to success of our customers while actively participating within the Solutions Consultant community and at industry events
Identifying technical stakeholders and cultivating relationships with key personas to build and drive a security architecture transformation roadmap
Qualifications
Your Experience
6+ years experience in pre-sales/sales engineering
Strong understanding of data networking, security architectures, and modern cloud computing environments
Experience in delivering cybersecurity solutions that solve technical challenges and influence new business initiatives is preferred
Influencing and gaining buy-in from key stakeholders, either in a customer-facing or internal role; prior experience in a pre-sales role is ideal
Creating and delivering technical presentations, workshops, or technical validation engagements
Experience in selling, designing, implementing, or managing one or more of the following solutions: Network Security, SASE, SaaS, CNAPP and/or SOC Transformation Technologies
Partnering with Customer Support functions to ensure successful implementation and adoption of sold solutions
Experience in complex sales involving long sales processes with multiple buying centers and multi-product solutions are preferred
This is a field sales position where travel requirements may be required to support in person customer meetings, please discuss with the recruiter on the specifics for this position.
Proficient in English
Compensation Disclosure
The compensation offered for this position will depend on qualifications, experience, and work location. For candidates who receive an offer at the posted level, the starting base salary (for non-sales roles) or base salary + commission target (for sales/com-missioned roles) is expected to be the annual range listed below. The offered compensation may also include restricted stock units and a bonus. A description of our employee benefits may be found here.
- /yr
Our Commitment
We’re trailblazers that dream big, take risks, and challenge cybersecurity’s status quo. It’s simple: we can’t accomplish our mission without erse teams innovating, together.
We are committed to providing reasonable accommodations for all qualified iniduals with a disability. If you require assistance or accommodation due to a disability or special need.
Palo Alto Networks is an equal opportunity employer. We celebrate ersity in our workplace, and all qualified applicants will receive consideration for employment without regard to age, ancestry, color, family or medical care leave, gender identity or expression, genetic information, marital status, medical condition, national origin, physical or mental disability, political affiliation, protected veteran status, race, religion, sex (including pregnancy), sexual orientation, or other legally protected characteristics.
All your information will be kept confidential according to EEO guidelines.

100% remote workaldeflga
Title: Housing Support Specialist
Location: Alabama, Delaware, Florida, Georgia, Idaho, Indiana, Kansas, Louisiana, Maine, Maryland, Minnesota, Nebraska, Nevada, New Hampshire, North Carolina, North Dakota, Ohio, Oklahoma, Pennsylvania, South Carolina, South Dakota, Tennessee, Texas, Utah, Virginia, Washington, West Virginia, Wisconsin, and Wyoming.
time type
Full time
job requisition id
JR-97742
City/State
Norfolk, VA
Work Shift
First (Days)
Overview:
Sentara Health is looking to hire a Remote Housing Support Specialist.
Candidates must reside in Charlottesville and/or surrounding areas as traveling in the field is required.
This job provides support to members with housing insecurity or who are experiencing homelessness, or who are returning to the community after a nursing home stay, to find and secure appropriate housing. Work involves property visits and community networking to maintain a thorough knowledge of housing and supportive resources. The Housing Services Specialist educates members about housing options to include Housing Choice Vouchers and low-income housing and provides referrals to suitable properties. This position collaborates with other housing specialists, social workers, and case managers, and carries a caseload of members in the Western region of the state.
Education:
- High School Diploma (required)
Experience:
- 1 - 3 years' experience in community outreach or customer service (required)
- 1 - 3 years' experience in assisting older adults, the elderly, and persons with disabilities to secure accessible, affordable housing (required)
- 1 - 3 years' experience working with low-income housing providers to develop accessible and affordable housing for older adults, elderly, and persons with disabilities (required)
- Healthcare experience (preferred)
Keywords: Talroo-Allied Health, Healthcare, Housing Support Specialist, Low Income, Community Outreach, Customer Service
Benefits: Caring For Your Family and Your Career
• Medical, Dental, Vision plans
• Adoption, Fertility and Surrogacy Reimbursement up to $10,000
• Paid Time Off and Sick Leave
• Paid Parental & Family Caregiver Leave
• Emergency Backup Care
• Long-Term, Short-Term Disability, and Critical Illness plans
• Life Insurance
• 401k/403B with Employer Match
• Tuition Assistance – $5,250/year and discounted educational opportunities through Guild Education
• Student Debt Pay Down – $10,000
• Reimbursement for certifications and free access to complete CEUs and professional development
•Pet Insurance
•Legal Resources Plan•Colleagues have the opportunity to earn an annual discretionary bonus if established system and employee eligibility criteria is met.Sentara Health is an equal opportunity employer and prides itself on the ersity and inclusiveness of its close to an almost 30,000-member workforce. Diversity, inclusion, and belonging is a guiding principle of the organization to ensure its workforce reflects the communities it serves.
In support of our mission “to improve health every day,” this is a tobacco-free environment.
For positions that are available as remote work, Sentara Health employs associates in the following states:
Alabama, Delaware, Florida, Georgia, Idaho, Indiana, Kansas, Louisiana, Maine, Maryland, Minnesota, Nebraska, Nevada, New Hampshire, North Carolina, North Dakota, Ohio, Oklahoma, Pennsylvania, South Carolina, South Dakota, Tennessee, Texas, Utah, Virginia, Washington, West Virginia, Wisconsin, and Wyoming.
Title: Coding Specialist - Ambulatory Srvs
Location: Wisconsin, Minnesota, Iowa
Full time
job requisition id
JR-30048
Love + medicine is who we are, it's what we do, it's why people want to work here. If you’re looking for a job to love, apply today.
Scheduled Weekly Hours:
40
Emplify Health by Gundersen is seeking a Coding Specialist, Ambulatory Services, to join our growing and thriving organization.
What's Available:
Monday - Friday, 40 hours a week, day shift
This is a Remote position, however candidates must live within a reasonable driving distance to La Crosse, WI to be able to come in for occasional meetings and training.
No weekends, No Holidays
Location: We only accept candidates from WI, IA, and MN.
Department: Primary Care
What you will do:
Provide LOVE + MEDICINE to our patients through providing the best first/last impressions with top-level customer service.
Partner with a team of providers, medical professionals, and managers who are here to support your success and that of our patients in their health journeys.
What you will get:
Starting wage of $21.15/hr + more for experience!
Competitive starting wage and excellent benefits package!
Support to grow in your career with access to our Career Development Center and Tuition Investment Program
Top-rated retirement plan and healthcare benefits
Departmental leadership that supports you as you do your best work.
Work/Life balance to love what you do and where you live.
What you need:
High School Diploma or equivalent - associate's degree desired
Coding Certification Required - CPC, CPC-A, CCA, COC, CCS, CCS-P, or RHIA or RHIT.
1 year of experience in a healthcare facility, healthcare business office or equivalent education.
1 year of Coding experience desired but not required.
Emplify Health is comprised of two of the Midwest’s most respected healthcare systems, Bellin Health and Gundersen Health System. Once neighbors, we are now partners, united in our mission to provide exceptional care to our communities. As a not-for-profit, patient-centered healthcare network, we have headquarters in Green Bay and La Crosse, Wisconsin. Our extensive network includes 11 hospitals and more than 100 clinics, serving 67 cities and rural communities across Wisconsin, Iowa, Minnesota and Michigan’s Upper Peninsula. With over 4,500 dedicated nurses and providers, we are committed to delivering primary, specialty and emergency care, along with innovative medical education programs. Join us in making a meaningful difference in the lives of our patients and communities.
We inspire your best life by relentlessly caring, learning and innovating. This is our purpose. Together with our values — belonging, respect, excellence, accountability, teamwork and humility — our pillars set our foundation and our future.
Equal Opportunity Employer
Title: Regional Corporate Senior Digital Operations Team Specialist
Location: Hunt Valley United States
Job Description:
The Regional Corporate Senior Digital Operations Team Specialist will be responsible for assisting an assigned regional group of stations to manage their digital account business. The Senior Specialist needs to be able to be detail-oriented in a fast-paced environment. In this role they will work alongside Sales and Sinclair/Amp Digital Operations. This position reports into the Corporate Digital Sales Operations Senior Manager.
Responsibilities:
- Responsible for sales support, pre- and post-sale, for Marketing Consultants from a group of assigned stations
- Will be the key point of contact for digital orders for assigned stations
- Must gain and maintain an understanding of our digital product offerings
- Resolve issues by taking the appropriate action and escalating issues to either corporate hub management or station sales management as needed
- Help with quotes, pulling invoicing, reporting and questions from sales teams on multiple campaigns
- Monitor campaign performance and make recommendations to sales teams
- Provide Marketing Consultants regular updates on campaign performance
- Must be able to understand digital reporting and analytic metrics
- Responsible for communication between ad ops and the client/sales team, acting as the liaison
- Work alongside and guide the Regional Corporate Digital Operations Team Specialist who enters digital orders and back up that Team Specialist as needed
- Work with the corporate digital billing team to resolve questions about orders or audit orders for accuracy.
- Must be comfortable providing education & training as needed
- Other duties as assigned
Skills and Qualifications:
- Bachelor’s Degree in Marketing, Business, Communications, or a related field
- 1-2 years of experience in digital sales or operations and customer service
- Proficiency with MS Office Suite (Outlook, Word, Excel)
- Strong understanding of AOS and Jira systems
- Excellent communication, problem-solving, and customer service skills
- Strong organizational skills, attention to detail, and ability to manage multiple priorities under deadlines.
Core Competencies:
- Customer-Centric Mindset: Demonstrates patience and empathy, ensuring positive interactions and support for internal stakeholders.
- Collaborative Spirit: Enjoys working with others to achieve shared goals and thrives in a team-oriented environment.
- Creative Problem-Solving: Brings innovative ideas to improve processes and enhance campaign performance.
- Adaptability: Handles shifting priorities and high-volume workloads with professionalism and efficiency.
- Proactive Support: Takes initiative to assist colleagues and resolve issues before they escalate.
- Enthusiasm for Helping Others: Gets excited about enabling fellow employees to succeed and contributing to overall team success.
Sinclair is proud to be an equal opportunity employer and a drug free workplace. Employment practices will not be influenced or affected by virtue of an applicant's or employee's race, color, religion, sex (including pregnancy, gender identity, and sexual orientation), national origin, age, disability, genetic information, military or veteran status or any other characteristic protected by law.
About Us
Sinclair, Inc. (Nasdaq: SBGI) is a ersified media company and a leading provider of local news and sports. The Company owns, operates, and/or provides services to 178 television stations in 81 markets affiliated with all major broadcast networks; owns Tennis Channel, the premium destination for tennis enthusiasts; multicast networks CHARGE, Comet, ROAR, and The Nest. Sinclair’s AMP Media produces a growing portfolio of digital content and original podcasts. Additional information about Sinclair can be found at www.sbgi.net.
About the Team
The life-blood of our organization is our people. We have a compelling story, a goal-oriented culture, and we take really good care of people. How good? Here is a glimpse: great benefits, open door policy, upward mobility and a strong desire to see you succeed. Ready to be part of a winning team? Let’s talk.
The hourly compensation range for this role is $20.91 to $24.30 with bonus potential. Final compensation for this role will be determined by various factors such as a candidate’s relevant work experience, skills, certifications, and geographic location. Full time positions are eligible for benefits that include participation in a retirement plan, life and disability insurance, health, dental and vision plans, flexible spending accounts, 15 paid vacation days, 2 paid personal days, 9 paid holidays, 40 hours of paid sick leave, parental leave, and employee stock purchase plan. This position is hybrid for Maryland-based employees, with regular time in our corporate office. We are also open to considering qualified remote candidates. Work arrangements will be determined based on location and business needs.
Please note that this position is not eligible for visa sponsorship, including employer sponsorship for an H-1B visa, OPT-STEM employment, etc.
Job Info
- Job Identification16424
- Job CategorySales
- Locations 10713 Gilroy Road, Hunt Valley, MD, 21030, US
- Job ScheduleFull time

100% remote workus national
Title: Senior Operations Manager
Location: Remote United States
Job Description:
Position Summary
Amerit Fleet Solutions, one of the leading fleet maintenance companies in the U.S., is seeking an experienced, inspired and mission-driven Senior Operations Manager on the East Coast to join our growing team!
The Senior Operations Manager is responsible for overseeing service operations. This is a remote position that may require up to 40-50% travel. This role involves a multi-faceted approach to maintenance, customer service and account management.
The SOM will have a strong background in operations as well as maintenance/fleet management. The scope of responsibilities will be the management and oversight for fleet managers and local administrators, across multiple regional sites, that will encompass teams of mechanics.
The SOM will oversee the day-to-day operations for the entire region and serve as the account manager. As the account manager the SOM will ensure and coordinate items like billing inquiries, monthly close out, reporting monthly metrics such as PM/DOT and other KPI data, to include SLA's, EHS and safety for the region. The SOM will be a direct conduit for all customer inquiries and feedback, to include monthly surveys, as well as host weekly and monthly meetings.
Candidates should have a strong and erse background in diesel repairs; servicing a large fleet of heavy-duty trucks, trailers and equipment.
We are looking for an experienced self-starter with excellent leadership and communication skills. Success will be based in uptime and readiness of the customers assets, an outstanding safety and quality record, EHS compliance, data management, communication, problem solving as well as staffing and overall business performance.
Compensation: Competitive Salary Pay - Paid weekly, every Friday! Salary range: $120,000-140,000 plus performance-based annual incentive plan.
The benefits of belonging - what's in it for you?
- Competitive salary pay - paid weekly, every Friday
- Full benefits within 30 days
- Medical, dental, vision, prescription drug coverage, life insurance, disability insurance
- 401(k) program
- Unlimited vacation, paid holidays, and sick time
- Commitment to your safety through boot and prescription safety glasses reimbursement
- Career and learning development with an extensive training program through our Amerit University
- Employee referral program, up to $1,000 bonus
- ASE certification program with fee reimbursement and bonus
- Employee recognition platform that includes opportunities to redeem points for merchandise
- Employee Assistance Program (EAP)
- 24/7 nurse triage line
- Employee discounts on cell phone service and entertainment tickets
- Employee resource groups (ERGs) that foster inclusion
- Wellness and fitness programs through our providers
What the role looks like:
- Ensure consistent delivery of customer KPIs/SLAs: day to day service levels, communication, system updates, as well as customer experience, quality, and compliance measures
- Responsible for the operations lead of your team and for the delivery of the overall metrics & quality targets
- Proactively partner with key client contacts fostering healthy business relationship in line with client expectations
- Day to day system updates and site reporting to ensure productivity: units are being scheduled, work is being performed timely, and customer business units are aware of the status of all equipment
- Proactive planning and scheduling or repairs, communication for down or out-of-service assets, as well a parts and inventory management across the footprint
- Ability to build partnerships and manage suppliers and third-party service vendors in support of parts, repairs, warranty work or specialty work
- Responsible for the development of the operational talent pool by optimizing the skills of the existing team, in partnership with our internal EHS, safety and training departments
- Have a well-defined communication and engagement model in place to ensure all teams understand the performance of the business and also that they understand the needs of their teams
- Responsibility and accountability for the operational performance of the client areas and for exceeding targets of all required metrics
- The continuous identification implementation of operational best practices through interaction with the wider team
- Motivate and effectively performance manage Operations and Team Managers within the account to ensure delivery of overall targets and business plan
- Selecting, effectively managing and coaching Operations and Team Managers
- Excellent leadership, people management, communication and influencing skills at a senior level
- Setting and reviewing as quality performance standards as well as team retention levels
- Managing client engagement
Our ideal candidate will have:
- Bachelor's degree preferred.
- Ten or more years of relevant experience in managing large fleets and maintenance
- Technical background to understand mechanical repairs, diagnosis, as well tooling, inventory, and fleet management systems
- Proven experience in management for operations, planning, maintenance, and customer service
- Great communication and data skills to include Outlook, Excel, and PowerPoint
- People skills. Ability to find and attract talented team members, train and retain highly effective employees to minimize service interruptions
- Proven ability to lead cross-functional teams leveraging a project management framework
- Strong analytical and problem-solving skills with extensive business acumen
- Excellent communication and intercultural skills
- Strong written and verbal communication skills
- A business focused way of thinking and a strong hands-on, results-driven mentality combined with a high desire to work strategically
- Passionate self-starter, decisive, able to partner with the customer and effect the desired outcomes
Working Conditions:
The physical demands described here are representative of those that must be met by an employee to successfully perform the essential functions of this job. Reasonable accommodations may be made to enable iniduals with disabilities to perform the essential functions.
- Ability to regularly lift and move up to 10 pounds
- Ability to stand, walk, sit, talk or hear
- Frequent use of hands and fingers
- Ability to feel and reach with hands and arms

100% remote workctdeflga
Sr. Customer Success Manager, Enterprise - East
Location: Work remotely from the Eastern US territory.
Job Description:
For over 20 years, Smartsheet has helped people and teams achieve-well, anything. From seamless work management to smart, scalable solutions, we've always worked with flow. We're building tools that empower teams to automate the manual, uncover insights, and scale smarter. But more than that, we're creating space- space to think big, take action, and unlock the kind of work that truly matters. Because when challenge meets purpose, and passion turns into progress, that's magic at work, and it's what we show up for everyday.
Smartsheet is looking for a Sr. Customer Success Manager to manage a set of large enterprise accounts and improve customer satisfaction, application engagement, customer retention, and growth. You will be the primary contact for customers, understanding their success criteria, sharing best practices, providing solution guidance, and helping them realize value from Smartsheet. You have a track record for Software as a Service (SaaS) account management and maintaining high customer renewal rates because of ongoing customer engagement and technical leadership.
You will report to a Sr. Manager of Customer Success and may work remotely from the Eastern US territory.
You Will:
- Perform initial onboarding of accounts with enterprise level customers, ensuring adoption and ongoing engagement throughout the customer's lifecycle
- Accomplish a comprehensive engagement and communications strategy that maintains high customer satisfaction
- Be the Smartsheet expert providing guidance to allow customers to create impact and increase collaboration across their organization and with external parties
- Perform periodic customer success reviews that confirm satisfaction, resolve issues with the help of the Technical Support team, and expand Smartsheet use throughout the account
- Implement and share best practices to ensure customers are realizing the greatest possible value from Smartsheet
- Use usage patterns to gain insights, provide guidance and increase customer adoption and satisfaction
- Be the primary interface to manage and resolve critical situations
- Work with the Sales, Training and Professional Services teams to identify new opportunities to expand customer use of Smartsheet
- Provide expert customer insight to Product Management, Marketing and Sales on innovation and continuous improvement opportunities
- Exceed all performance targets, including maintaining high retention and growth rates
- Accomplish other tasks as assigned
You Have:
- 3+ years of Customer Success or Account Management experience (or equivalent)
- State & Local Government (SLG) experience (preferred)
- The ability to explain technical subjects to non-technical personnel in large enterprises
- Good at building credibility and trust with customers and internal stakeholders by understanding their requirements
- Experience maintaining valuable and outcome-based relationships with a erse customer account base
- Passion for working with leading edge, web-based technologies and a desire to understand Smartsheet's benefits, use cases, and technical elements
- Bachelor's degree in relevant field, or equivalent experience
- Willing to travel based on customer and business need
Current US Perks & Benefits:
- Employer subsidized medical/vision and dental coverage for full-time employees
- 401k Match to help you save for your future (50% of your contribution up to the first 6% of your eligible pay)
- Monthly stipend to support your work and productivity
- Flexible Time Away Program, plus Sick Time Off
- US employees are automatically covered under Smartsheet-sponsored life insurance, short-term, and long-term disability plans
- US employees receive 12 paid holidays per year
- Up to 24 weeks of Parental Leave
- Personal paid Volunteer Day to support our community
- Opportunities for professional growth and development including access to Udemy online courses
- Company Funded Perks, including a counseling membership, local retail discounts, and your own personal Smartsheet account
- Teleworking options from any registered location in the U.S. (role specific)
Smartsheet provides a competitive base salary range for roles that may be hired in different geographic areas we are licensed to operate our business from. Actual compensation is determined by several factors including, but not limited to, level of professional, educational experience, skills, and specific candidate location. In addition, this role will be eligible for a market competitive incentive opportunity.
US Base Salary Pay Range
$112,500 - $142,500 USD
Get to Know Us:
At Smartsheet, your ideas are heard, your potential is supported, and your contributions have real impact. You'll have the freedom to explore, push boundaries, and grow beyond your role. We welcome erse perspectives and nontraditional paths-because we know that impact comes from iniduals who care deeply and challenge thoughtfully. When you're doing work that stretches you, excites you, and connects you to something bigger, that's magic at work. Let's build what's next, together.
Equal Opportunity Employer:
Smartsheet is an Equal Opportunity (EEO) employer committed to fostering an inclusive environment with the best employees. It is our policy to provide equal employment opportunities to all qualified applicants in accordance with applicable laws in the US, UK, Australia, Germany, Costa Rica, Japan, Bulgaria, and India. All qualified applicants will receive consideration without regard to race, color, religion, sex, sexual orientation, gender identity, national origin, age, protected veteran or disabled status, or genetic information.
If there are preparations we can make to help ensure you have a comfortable and positive interview experience, please let us know.
#LI-Remote
Title: Financial Clearance Representative Associate
Location: Minneapolis, MN, USA; Remote USA
Overtime status: Non-exempt
Travel: No
Job Description:
Opportunities at Optum, in strategic partnership with Allina Health. As an Optum employee, you will provide support to the Allina Health account. The work you do with our team will directly improve health outcomes by connecting people with the care, pharmacy benefits, data and resources they need to feel their best. Here, you will find a culture guided by ersity and inclusion, talented peers, comprehensive benefits and career development opportunities. Come make an impact on the communities we serve as you help us advance health equity on a global scale. Join us to start Caring. Connecting. Growing together.
The Financial Clearance Representative Associate is responsible for completing the financial clearance process and creating the first impression of Optum services to patients, their families, and other external customers. You will articulate information in a manner that patients, guarantors, and family members understand and will know what to expect regarding their financial responsibilities. Work with medical staff, nursing, ancillary departments, insurance payers, and other external sources to assist families in obtaining healthcare and financial services.
You will enjoy the flexibility to telecommute* from anywhere within the U.S. as you take on some tough challenges.
Primary Responsibilities:
- Review and analyze patient visit information to determine whether authorization is needed and understands payor specific criteria to appropriately secure authorization and clear the account prior to service where possible
- Ensure that initial and all subsequent authorizations are obtained in a timely manner
- May provide mentoring to less experienced team members on all aspects of the revenue cycle, payer issues, policy issues, or anything that impacts their role
- Meet and maintain department productivity and quality expectations
You'll be rewarded and recognized for your performance in an environment that will challenge you and give you clear directions on what it takes to succeed in your role as well as provide development for other roles you may be interested in.
Required Qualifications:
- High School Diploma/GED
- 6+ months of experience with Physical/Occupational/Speech Therapy prior authorizations in healthcare setting
- Intermediate level of proficiency with Microsoft Office products
- Ability to work within Central Time zone standard daytime hours
- Must be 18 years of age OR older
Preferred Qualifications:
- Associate or Vocational Degree in Business Administration, Health Care Administration, Public Health or related field of study
- EPIC experience
- Experience with insurance and benefit verification, Pre-Registration and/or Prior Authorization activities in healthcare business/office setting
- Experience working with clinical staff
- Experience working with clinical documentation
- Experience working with a patient's clinical medical record
Soft Skills:
- Excellent customer service skills
- Excellent written and verbal communication skills
- Demonstrated ability to work in fast paced environments
- All Telecommuters will be required to adhere to UnitedHealth Group's Telecommuter Policy.
Pay is based on several factors including but not limited to local labor markets, education, work experience, certifications, etc. In addition to your salary, we offer benefits such as, a comprehensive benefits package, incentive and recognition programs, equity stock purchase and 401k contribution (all benefits are subject to eligibility requirements). No matter where or when you begin a career with us, you'll find a far-reaching choice of benefits and incentives. The hourly pay for this role will range from $16.15 to $28.80 per hour based on full-time employment. We comply with all minimum wage laws as applicable.
Pursuant to the San Francisco Fair Chance Ordinance, we will consider for employment qualified applicants with arrest and conviction records.
Application Deadline: This will be posted for a minimum of 2 business days or until a sufficient candidate pool has been collected. Job posting may come down early due to volume of applicants.
At UnitedHealth Group, our mission is to help people live healthier lives and make the health system work better for everyone. We believe everyone-of every race, gender, sexuality, age, location, and income-deserves the opportunity to live their healthiest life. Today, however, there are still far too many barriers to good health which are disproportionately experienced by people of color, historically marginalized groups, and those with lower incomes. We are committed to mitigating our impact on the environment and enabling and delivering equitable care that addresses health disparities and improves health outcomes - an enterprise priority reflected in our mission.
UnitedHealth Group is an Equal Employment Opportunity employer under applicable law and qualified applicants will receive consideration for employment without regard to race, national origin, religion, age, color, sex, sexual orientation, gender identity, disability, or protected veteran status, or any other characteristic protected by local, state, or federal laws, rules, or regulations.
UnitedHealth Group is a drug-free workplace. Candidates are required to pass a drug test before beginning employment.
#RPO #GREEN

100% remote workazcaidlas vegas
Title: Care Manager - Patient Support Call Center
-Remote
Location:
Olympia, United States of America | Full time | Home-based | R1541049
Job available in additional locations
Phoenix, United States of AmericaLas Vegas, United States of AmericaPocatello, United States of AmericaRedondo Beach, United States of AmericaSalem, United States of AmericaSan Jose, United States of AmericaVancouver, United States of America
Job Description:
This is posted in anticipation of a future role
Position Summary:
Care Managers are responsible for contacting insurance companies to obtain correct eligibility information, perform benefit investigations, copay assistance and check prior authorization and/ or appeal status.
The information contained herein is intended to be an accurate reflection of the duties and responsibilities of the iniduals assigned to this position. They are not intended to be an exhaustive list of the skills and abilities required to do the job. IQVIA reserves the right to revise the job or to require that other or different tasks be performed as assigned.
Care Manager
As the only global provider of commercial solutions, IQVIA understands what it takes to deliver nationally and internationally. Our teams help biopharma get their medicines to the people who need them. We help customers gain insight and access to their markets and ultimately demonstrate their product's value to payers, physicians, and patients. A significant part of our business is acting as the biopharma's sales force to physicians or providing nurses to educate patients or prescribers. With the right experience, you can help deliver medical breakthroughs in the real world.
Position Summary:
Responsibilities will vary by program and its lifecycle. Care Manager's maybe responsible forcontacting insurance companies to obtain correct eligibility information, perform benefit investigations, copay assistance, and checking prior authorization and/or appeal status. Care Managers may alsobe responsible fordirectly contacting patients and/or providers to evaluate eligibility for assistance programs and/or varied adherence support. This is a remote position.
Job Responsibilities:
Perform outbound calls to obtain appropriate information and document accurately.
Responsible for answering in-bound calls and assisting customers with pharmacy-related services.
Maintain strict professionalism in all communication methods while providing efficient, courteous, and friendly service.
Contact insurance companies for benefit investigation and coverage eligibility.
Provide prior authorizations and appeals support.
Assist patients with the enrollment process for manufacturer and non-profit organization copay assistance programs.
Update job knowledge by participating in educational opportunities and training activities. Work efficiently both inidually and within a team to accomplish required tasks.
Maintain and improve quality results by adhering to standards and guidelines by meeting quality standards set forth by program KPI's.
Report ADE's according to program policy and guidelines. Adhere to all HIPAA guidelines. May assist with onboarding new employees.
Schedule:
- Must be available for an 8-hour shift between 8am-8pm EST
Required Qualifications:
High School Diploma or equivalent
Minimum one year of experience in medical billing, reimbursement, insurance verification, or similar related medical office experience.
Previous data entry experience (minimum three months) and ability to type 30wpm+.
Able to demonstrate high attention to detail in work.
Mustbe computer savvy,to include navigating multiple computer tabs,monitors,and applications.
Advanced ability/knowledge of all Microsoft Suite programs (Teams, Word, Excel, Outlook,etc.) and soft phone systems (WebEx, Mitel,Shoretel, etc.).
Exceptional communication skills, both written and verbal.
Able to work in a virtual team environment by being available and responsive during working hours.
Excellent follow through This is a remote position.
Employees must have a private workspace free of distraction to adhere to HIPAA compliance/guidelines.
Workspace must include internet plug-in accessibility. Wi-fi connectivity is notpermitted.
Mustresidein country wherethe jobis posted.
Preferred Qualifications:
Some College.
Bilingual Spanish - English
Previousexperience in Patient Support Services (Hub).
PreviousCustomer Service experience in the healthcare field.
#LI-CES
#LI-DNP
IQVIA is a leading global provider of clinical research services, commercial insights and healthcare intelligence to the life sciences and healthcare industries. We create intelligent connections to accelerate the development and commercialization of innovative medical treatments to help improve patient outcomes and population health worldwide. Learn more at https://jobs.iqvia.com
IQVIA is proud to be an equal opportunity employer. All qualified applicants will receive consideration for employment without regard to race, color, religion, sex, sexual orientation, gender identity, national origin, disability, status as a protected veteran, or any other status protected by applicable law. https://jobs.iqvia.com/eoe
IQVIA is committed to integrity in our hiring process and maintains a zero tolerance policy for candidate fraud. All information and credentials submitted in your application must be truthful and complete. Any false statements, misrepresentations, or material omissions during the recruitment process will result in immediate disqualification of your application, or termination of employment if discovered later, in accordance with applicable law. We appreciate your honesty and professionalism.
The potential base pay range for this role is $22.00 - $23.00 per hour. The actual base pay offered may vary based on a number of factors including job-related qualifications such as knowledge, skills, education, and experience; location; and/or schedule (full or part-time). Dependent on the position offered, incentive plans, bonuses, and/or other forms of compensation may be offered, in addition to a range of health and welfare and/or other benefits.

100% remote workamarilloaustindallasel paso
Title: Sales Representative, Inbound
Remote
Location: Plano, Texas, United States • Dallas, Texas, United States • Houston, Texas, United States • San Antonio, Texas, United States • Frisco, Texas, United States • McKinney, Texas, United States • Austin, Texas, United States • Amarillo, Texas, United States • El Paso, Texas, United States
Job Description:
Description
Apply Today - Training Classes Begin May and June 2026!
Are you ready to launch a rewarding career in insurance sales? We're seeking motivated, people-focused iniduals to join our Inside Sales Representative team. Secure your spot early for our upcoming 2026 training cohorts and take the first step toward a meaningful, growth‑oriented role.
Key Date:
- Unlicensed Class: May 18, 2026
- Licensed Class: June 1, 2026
- Unlicensed Class: June 29, 2026
Start your journey with us and build a career where your talent and passion for helping others truly make an impact.
As an Inside Sales Representative at Liberty Mutual, you'll have the tools, training and support you need to succeed from day one.
Plus, you'll enjoy:
- Generous earning potential
- Paid licensing and training opportunities
- Comprehensive benefits
- Flexible work arrangements
- Strong work-life balance
- And more!
Why Liberty Mutual?
Pay Details:
- Starting base salary is $45K with opportunity for growth.
- Average earnings range from $55K-$75K through a combination of base salary and generous commission.
- Top Performing Agents in their second year and onward, can earn up to $85k+.
Our Sales Representative, Inbound Remote position is available for candidates based in the state of Texas. Applicants must reside within the specified location to be considered for this role.
Positivity. Flexibility. Determination and a persuasive personality. Qualities like these cannot be taught. But they can be sharpened, strengthened, and appropriately compensated when you join Liberty Mutual Insurance as a part of our Contact Center Sales Organization. Bring your unique sales talent to our Fortune 100 company and receive paid-training, licensing in all 50 states, and a dynamic role that directs only warm leads your way (no cold calls) - because we believe in supporting your success, not holding it back. Join our sales team and realize the rewards of a career with unlimited earning potential, generous commissions, and a portfolio of benefits that start on day one.
Job Details
As an Inside Sales Agent you will be handling inbound calls and warm leads, consulting with customers on their insurance needs and match the correct coverages, products, and benefits to convert sales leads into policyholders.
You'd be a great fit if you are:
A Passionate Seller: When a lead comes in, you skillfully pick up the phone and use your sales expertise to turn prospects into happy, confident Liberty Mutual policyholders.
A Front Lines Liaison: You rise to the role of representing the Liberty brand, you believe in what you're selling, and you enjoy connecting customers to the right products for their inidual needs.
A Reliable Teammate: Whether you work at the office or from home, you adapt well to different environments, schedules, and the varying needs of our policyholders.
A Customer-Centric Closer: While sales is in your title, integrity is in your nature. That means you sincerely care that our customers get exactly the quality products and services they need to embrace today and confidently pursue tomorrow.
Position Details:
From day one you will begin paid training in a remote work environment. All insurance representatives need to hold a Property & Casualty Insurance license. If you do not have one, no worries, paid training also includes licensing!
- Training extends over a period of 16 weeks for licensed hires and 18 weeks for unlicensed hires.
- Comprehensive medical benefits from Day 1.
- No cold calls, all incoming warm leads.
- Opportunities for rewards and recognition.
- Must be available to work a schedule of 4 weekdays and 1 weekend day with a mid-morning start time. Example 11am-8pm (CST). This schedule can be expected for a minimum of 12 months before consideration for another shift.
- All computer equipment is provided. You must be able to maintain department. Work at home (W@H) requirements which include a professional workspace/room with a dedicated desk and wired (cable, fiber of DSL service) high-speed internet connection with a minimum 100 MBps download speed and 20 MBps upload speed. Liberty Mutual does not support satellite and mobile internet services.
Qualifications
- 2-3 years sales experience preferred. 2 years of sales/service-related work experience required.
- Strong, engaging interpersonal and persuasion skills needed to close sales.
- Ability to communicate well to both prospects and customers.
- Excellent analytical, decision-making and organizational skills.
- Strong typing capabilities and PC proficiency.
- Property and Casualty Insurance License. Training will be provided if you do not currently hold a license.
About Us
Pay Philosophy: The typical starting salary range for this role is determined by a number of factors including skills, experience, education, certifications and location. The full salary range for this role reflects the competitive labor market value for all employees in these positions across the national market and provides an opportunity to progress as employees grow and develop within the role. Some roles at Liberty Mutual have a corresponding compensation plan which may include commission and/or bonus earnings at rates that vary based on multiple factors set forth in the compensation plan for the role.
At Liberty Mutual, our goal is to create a workplace where everyone feels valued, supported, and can thrive. We build an environment that welcomes a wide range of perspectives and experiences, with inclusion embedded in every aspect of our culture and reflected in everyday interactions. This comes to life through comprehensive benefits, workplace flexibility, professional development opportunities, and a host of opportunities provided through our Employee Resource Groups. Each employee plays a role in creating our inclusive culture, which supports every inidual to do their best work. Together, we cultivate a community where everyone can make a meaningful impact for our business, our customers, and the communities we serve.
We value your hard work, integrity and commitment to make things better, and we put people first by offering you benefits that support your life and well-being. To learn more about our benefit offerings please visit: https://www.libertymutualgroup.com/about-lm/careers/benefits
Liberty Mutual is an equal opportunity employer. We will not tolerate discrimination on the basis of race, color, national origin, sex, sexual orientation, gender identity, religion, age, disability, veteran's status, pregnancy, genetic information or on any basis prohibited by federal, state or local law.
Fair Chance Notices
- California
- Los Angeles Incorporated
- Los Angeles Unincorporated
- Philadelphia
- San Francisco

100% remote worknew yorkny
Title: Senior Solutions Consultant
(Design)
Location: New York United States
Job Description:
Job Description
Join the team redefining how the world experiences design.
Hello, hey, g'day, mabuhay, kia ora, 你好, hallo, vítejte!
Thanks for stopping by. We know job hunting can be a little time-consuming, and you're probably keen to find out what's on offer, so we'll get straight to the point.
Where and how you can work
Our flagship office is in Sydney, Australia - and today our teams collaborate across the globe. This is a remote role based in New York, with the flexibility to work from home. We trust our Canvanauts to find the balance that empowers them and their team to achieve their goals.
What you'd be doing in this role
As a Senior Solutions Consultant (Design), you'll partner with our Strategic and Enterprise Account Executives across North America to uncover customer needs, shape enterprise solutions, and deliver demos that resonate with design, brand, and marketing teams (and the wider organisation). You'll bring creative workflows to life - from brand governance and template systems to collaboration and AI-assisted creation - helping customers scale how they create.
At the moment, this role is focused on:
Leading high-impact discovery with enterprise customers to understand creative workflows and pain points
Designing and delivering tailored Canva demos for brand, design, and marketing stakeholders
Advising on brand governance, template systems, approval workflows, and scalable self-serve creation
Creating reusable playbooks, enablement content, and solution guides to scale impact across AMER
Collaborating cross-functionally with Sales, Customer Success, Implementation, Product, and Technical Pre-Sales to support the full customer journey
You're probably a match if:
You've worked in pre-sales, solutions consulting, consulting, enterprise onboarding, or creative ops
You have a background in graphic design, brand design or creative operations - and you understand how brand and marketing teams operate
You're confident facilitating workshops and presenting to senior stakeholders and large groups
You're organized, calm under pressure, and comfortable running multiple opportunities at once
You bring strong visual storytelling and a designer's eye to every customer interaction
What's in it for you?
Achieving our crazy big goals motivates us to work hard - and we do - but you'll experience lots of moments of magic, connectivity and fun woven throughout life at Canva, too. We also offer a range of benefits to set you up for every success in and outside of work.
Here's a taste of what's on offer:
Equity packages - we want our success to be yours too
Health benefits plans to support you and your wellbeing
401(k) retirement plan with company contribution
Inclusive parental leave policy that supports all parents & carers
An annual Vibe & Thrive allowance to support your wellbeing, social connection, office setup & more
Flexible leave options that empower you to be a force for good, take time to recharge and supports you personally
Check out lifeatcanva.com for more info.
At Canva we value fairness, and we strive to provide competitive, market-informed compensation whilst ensuring internal equity within the team in each region. We make hiring decisions based on your skills, experience and our overall assessment of what we observed and learnt in the hiring process. The target salary range for this position is USD $163,000 - $187,000. When calculating offers, we make salary decisions based on market data and candidates' skills and experience.
Other stuff to know
We make hiring decisions based on your experience, skills, merit and business needs, in compliance with applicable local laws.
We celebrate all types of skills and backgrounds at Canva so even if you don't feel like your skills quite match what's listed above - we still want to hear from you!
When you apply, please tell us the pronouns you use and any reasonable adjustments you may need during the interview process. Please note that interviews are conducted virtually.
Check out lifeatcanva.com for more info.

100% remote workflfort myersjacksonvillelake mary
Title: Sales Representative, Inbound
Remote
Location: Lake Mary, Florida, United States • Orlando, Florida, United States • Jacksonville, Florida, United States • Tampa, Florida, United States • Miami, Florida, United States • Fort Myers, Florida, United States • Tallahassee, Florida, United States • St Petersburg, Florida, United States • St. Augustine, Florida, United States
Job Description:
Description
Apply Today - Training Classes Begin June and July 2026!
Are you ready to launch a rewarding career in insurance sales? We're seeking motivated, people-focused iniduals to join our Inside Sales Representative team. Secure your spot early for our upcoming 2026 training cohorts and take the first step toward a meaningful, growth‑oriented role.
Key Date:
- Licensed Class: June 1, 2026
- Unlicensed Class: June 29, 2026
- Licensed Class: July 13, 2026
Start your journey with us and build a career where your talent and passion for helping others truly make an impact.
As an Inside Sales Representative at Liberty Mutual, you'll have the tools, training and support you need to succeed from day one.
Plus, you'll enjoy:
- Generous earning potential
- Paid licensing and training opportunities
- Comprehensive benefits
- Flexible work arrangements
- Strong work-life balance
- And more!
Why Liberty Mutual?
Pay Details:
- Starting base salary is $45K with opportunity for growth.
- Average earnings range from $55K-$75K through a combination of base salary and generous commission.
- Top Performing Agents in their second year and onward, can earn up to $85k+.
Our Sales Representative, Inbound Remote position is available for candidates based in the state of Florida. Applicants must reside within the specified location to be considered for this role.
Positivity. Flexibility. Determination and a persuasive personality. Qualities like these cannot be taught. But they can be sharpened, strengthened, and appropriately compensated when you join Liberty Mutual Insurance as a part of our Contact Center Sales Organization. Bring your unique sales talent to our Fortune 100 company and receive paid-training, licensing in all 50 states, and a dynamic role that directs only warm leads your way (no cold calls) - because we believe in supporting your success, not holding it back. Join our sales team and realize the rewards of a career with unlimited earning potential, generous commissions, and a portfolio of benefits that start on day one.
Job Details
As an Inside Sales Agent you will be handling inbound calls and warm leads, consulting with customers on their insurance needs and match the correct coverages, products, and benefits to convert sales leads into policyholders.
You'd be a great fit if you are:
A Passionate Seller: When a lead comes in, you skillfully pick up the phone and use your sales expertise to turn prospects into happy, confident Liberty Mutual policyholders.
A Front Lines Liaison: You rise to the role of representing the Liberty brand, you believe in what you're selling, and you enjoy connecting customers to the right products for their inidual needs.
A Reliable Teammate: Whether you work at the office or from home, you adapt well to different environments, schedules, and the varying needs of our policyholders.
A Customer-Centric Closer: While sales is in your title, integrity is in your nature. That means you sincerely care that our customers get exactly the quality products and services they need to embrace today and confidently pursue tomorrow.
Position Details:
From day one you will begin paid training in a remote work environment. All insurance representatives need to hold a Property & Casualty Insurance license. If you do not have one, no worries, paid training also includes licensing!
- Training extends over a period of 16 weeks for licensed hires and 18 weeks for unlicensed hires.
- Comprehensive medical benefits from Day 1.
- No cold calls, all incoming warm leads.
- Opportunities for rewards and recognition.
- Must be available to work a schedule of 4 weekdays and 1 weekend day with a mid-morning start time. Example 11am-8pm (CST). This schedule can be expected for a minimum of 12 months before consideration for another shift.
- All computer equipment is provided. You must be able to maintain department. Work at home (W@H) requirements which include a professional workspace/room with a dedicated desk and wired (cable, fiber of DSL service) high-speed internet connection with a minimum 100 MBps download speed and 20 MBps upload speed. Liberty Mutual does not support satellite and mobile internet services.
Qualifications
- 2-3 years sales experience preferred. 2 years of sales/service-related work experience required.
- Strong, engaging interpersonal and persuasion skills needed to close sales
- Ability to communicate well to both prospects and customers
- Excellent analytical, decision-making and organizational skills
- Strong typing capabilities and PC proficiency
- Property and Casualty License required after hire.
About Us
Pay Philosophy: The typical starting salary range for this role is determined by a number of factors including skills, experience, education, certifications and location. The full salary range for this role reflects the competitive labor market value for all employees in these positions across the national market and provides an opportunity to progress as employees grow and develop within the role. Some roles at Liberty Mutual have a corresponding compensation plan which may include commission and/or bonus earnings at rates that vary based on multiple factors set forth in the compensation plan for the role.
At Liberty Mutual, our goal is to create a workplace where everyone feels valued, supported, and can thrive. We build an environment that welcomes a wide range of perspectives and experiences, with inclusion embedded in every aspect of our culture and reflected in everyday interactions. This comes to life through comprehensive benefits, workplace flexibility, professional development opportunities, and a host of opportunities provided through our Employee Resource Groups. Each employee plays a role in creating our inclusive culture, which supports every inidual to do their best work. Together, we cultivate a community where everyone can make a meaningful impact for our business, our customers, and the communities we serve.
We value your hard work, integrity and commitment to make things better, and we put people first by offering you benefits that support your life and well-being. To learn more about our benefit offerings please visit: https://www.libertymutualgroup.com/about-lm/careers/benefits
Liberty Mutual is an equal opportunity employer. We will not tolerate discrimination on the basis of race, color, national origin, sex, sexual orientation, gender identity, religion, age, disability, veteran's status, pregnancy, genetic information or on any basis prohibited by federal, state or local law.
Fair Chance Notices
- California
- Los Angeles Incorporated
- Los Angeles Unincorporated
- Philadelphia
- San Francisco

100% remote workamarilloaustindallasel paso
Title: Sales Representative, Inbound
Remote
Location: Plano, Texas, United States • Dallas, Texas, United States • Houston, Texas, United States • San Antonio, Texas, United States • Frisco, Texas, United States • McKinney, Texas, United States • Austin, Texas, United States • Amarillo, Texas, United States • El Paso, Texas, United States
Job Description:
Description
Apply Today - Training Classes Begin June and July 2026!
Are you ready to launch a rewarding career in insurance sales? We're seeking motivated, people-focused iniduals to join our Inside Sales Representative team. Secure your spot early for our upcoming 2026 training cohorts and take the first step toward a meaningful, growth‑oriented role.
Key Date:
- Licensed Class: June 1, 2026
- Unlicensed Class: June 29, 2026
- Licensed Class: July 13, 2026
Start your journey with us and build a career where your talent and passion for helping others truly make an impact.
As an Inside Sales Representative at Liberty Mutual, you'll have the tools, training and support you need to succeed from day one.
Plus, you'll enjoy:
- Generous earning potential
- Paid licensing and training opportunities
- Comprehensive benefits
- Flexible work arrangements
- Strong work-life balance
- And more!
Why Liberty Mutual?
Pay Details:
- Starting base salary is $45K with opportunity for growth.
- Average earnings range from $55K-$75K through a combination of base salary and generous commission.
- Top Performing Agents in their second year and onward, can earn up to $85k+.
Our Sales Representative, Inbound Remote position is available for candidates based in the state of Texas. Applicants must reside within the specified location to be considered for this role.
Positivity. Flexibility. Determination and a persuasive personality. Qualities like these cannot be taught. But they can be sharpened, strengthened, and appropriately compensated when you join Liberty Mutual Insurance as a part of our Contact Center Sales Organization. Bring your unique sales talent to our Fortune 100 company and receive paid-training, licensing in all 50 states, and a dynamic role that directs only warm leads your way (no cold calls) - because we believe in supporting your success, not holding it back. Join our sales team and realize the rewards of a career with unlimited earning potential, generous commissions, and a portfolio of benefits that start on day one.
Job Details
As an Inside Sales Agent you will be handling inbound calls and warm leads, consulting with customers on their insurance needs and match the correct coverages, products, and benefits to convert sales leads into policyholders.
You'd be a great fit if you are:
A Passionate Seller: When a lead comes in, you skillfully pick up the phone and use your sales expertise to turn prospects into happy, confident Liberty Mutual policyholders.
A Front Lines Liaison: You rise to the role of representing the Liberty brand, you believe in what you're selling, and you enjoy connecting customers to the right products for their inidual needs.
A Reliable Teammate: Whether you work at the office or from home, you adapt well to different environments, schedules, and the varying needs of our policyholders.
A Customer-Centric Closer: While sales is in your title, integrity is in your nature. That means you sincerely care that our customers get exactly the quality products and services they need to embrace today and confidently pursue tomorrow.
Position Details:
From day one you will begin paid training in a remote work environment. All insurance representatives need to hold a Property & Casualty Insurance license. If you do not have one, no worries, paid training also includes licensing!
- Training extends over a period of 16 weeks for licensed hires and 18 weeks for unlicensed hires.
- Comprehensive medical benefits from Day 1.
- No cold calls, all incoming warm leads.
- Opportunities for rewards and recognition.
- Must be available to work a schedule of 4 weekdays and 1 weekend day with a mid-morning start time. Example 11am-8pm (CST). This schedule can be expected for a minimum of 12 months before consideration for another shift.
- All computer equipment is provided. You must be able to maintain department. Work at home (W@H) requirements which include a professional workspace/room with a dedicated desk and wired (cable, fiber of DSL service) high-speed internet connection with a minimum 100 MBps download speed and 20 MBps upload speed. Liberty Mutual does not support satellite and mobile internet services.
Qualifications
- 2-3 years sales experience preferred. 2 years of sales/service-related work experience required.
- Strong, engaging interpersonal and persuasion skills needed to close sales.
- Ability to communicate well to both prospects and customers.
- Excellent analytical, decision-making and organizational skills.
- Strong typing capabilities and PC proficiency.
- Property and Casualty Insurance License. Training will be provided if you do not currently hold a license.
About Us
Pay Philosophy: The typical starting salary range for this role is determined by a number of factors including skills, experience, education, certifications and location. The full salary range for this role reflects the competitive labor market value for all employees in these positions across the national market and provides an opportunity to progress as employees grow and develop within the role. Some roles at Liberty Mutual have a corresponding compensation plan which may include commission and/or bonus earnings at rates that vary based on multiple factors set forth in the compensation plan for the role.
At Liberty Mutual, our goal is to create a workplace where everyone feels valued, supported, and can thrive. We build an environment that welcomes a wide range of perspectives and experiences, with inclusion embedded in every aspect of our culture and reflected in everyday interactions. This comes to life through comprehensive benefits, workplace flexibility, professional development opportunities, and a host of opportunities provided through our Employee Resource Groups. Each employee plays a role in creating our inclusive culture, which supports every inidual to do their best work. Together, we cultivate a community where everyone can make a meaningful impact for our business, our customers, and the communities we serve.
We value your hard work, integrity and commitment to make things better, and we put people first by offering you benefits that support your life and well-being. To learn more about our benefit offerings please visit: https://www.libertymutualgroup.com/about-lm/careers/benefits
Liberty Mutual is an equal opportunity employer. We will not tolerate discrimination on the basis of race, color, national origin, sex, sexual orientation, gender identity, religion, age, disability, veteran's status, pregnancy, genetic information or on any basis prohibited by federal, state or local law.
Fair Chance Notices
- California
- Los Angeles Incorporated
- Los Angeles Unincorporated
- Philadelphia
- San Francisco

100% remote workazchandlermesaparadise valley
Title: Sales Representative, Inbound
Remote
Location: Chandler, Arizona, United States • Tempe, Arizona, United States • Phoenix, Arizona, United States • Mesa, Arizona, United States • Scottsdale, Arizona, United States • Paradise Valley, Arizona, United States • Tucson, Arizona, United States • Peoria, Arizona, United States • Queen Creek, Arizona, United States
Job Description:
Description
Apply Today - Training Classes Begin June 2026!
Are you ready to launch a rewarding career in insurance sales? We're seeking motivated, people-focused iniduals to join our Inside Sales Representative team. Secure your spot early for our upcoming 2026 training cohorts and take the first step toward a meaningful, growth‑oriented role.
Key Date:
- Licensed Class: June 1, 2026
- Unlicensed Class: June 29, 2026
Start your journey with us and build a career where your talent and passion for helping others truly make an impact.
As an Inside Sales Representative at Liberty Mutual, you'll have the tools, training and support you need to succeed from day one.
Plus, you'll enjoy:
- Generous earning potential
- Paid licensing and training opportunities
- Comprehensive benefits
- Flexible work arrangements
- Strong work-life balance
- And more!
Why Liberty Mutual?
Pay Details:
- Starting base salary is $45K with opportunity for growth + generous commission.
- Average first year earnings range from $55K-$75K through a combination of base salary and generous commission.
- Top Performing Agents in their second year and onward, can earn up to $85k+.
Our Sales Representative, Inbound Remote position is available for candidates based in the state of Arizona. Applicants must reside within this specified location to be considered for this role.
Positivity. Flexibility. Determination and a persuasive personality. Qualities like these cannot be taught. But they can be sharpened, strengthened, and appropriately compensated when you join Liberty Mutual Insurance as a part of our Contact Center Sales Organization. Bring your unique sales talent to our Fortune 100 company and receive paid-training, licensing in all 50 states, and a dynamic role that directs only warm leads your way (no cold calls) - because we believe in supporting your success, not holding it back. Join our sales team and realize the rewards of a career with unlimited earning potential, generous commissions, and a portfolio of benefits that start on day one.?
Job Details
As an Inbound Sales Representative you will be handling inbound calls and warm leads, consulting with potential and existing policyholders on their insurance needs and matching the correct coverages, products, and benefits to convert sales leads into policyholders.
You'd be a great fit if you are:
A Passionate Seller: When a lead comes in, you skillfully pick up the phone and use your sales expertise to turn prospects into happy, confident Liberty Mutual policyholders.
A Front Lines Liaison: You rise to the role of representing the Liberty brand, you believe in what you're selling, and you enjoy connecting customers to the right products for their inidual needs.
A Reliable Teammate: Whether you work at the office or from home, you adapt well to different environments, schedules, and the varying needs of our policyholders.
A Customer-Centric Closer: While sales is in your title, integrity is in your nature. That means you sincerely care that our customers get exactly the quality products and services they need to embrace today and confidently pursue tomorrow.
Position Details:
From day one you will begin paid training in a remote work environment. All Inbound Sales Representatives need to hold a Property & Casualty Insurance license. If you do not have one, no worries, paid training also includes licensing!
- Training extends over a period of 16 weeks for licensed hires and 18 weeks for unlicensed hires.
- Comprehensive medical benefits from Day 1.
- No cold calls, all incoming warm leads.
- Opportunities for rewards and recognition.
- Must be available to work a schedule of 4 weekdays and 1 weekend day with a mid-morning start time. Example 11am-8pm (CST). This schedule can be expected for a
minimum of 12 months before consideration for another shift.
- All computer equipment is provided. You must be able to maintain department work at home (W@H) requirements which include a professional workspace/room with a dedicated desk and wired (cable, fiber of DSL service) high-speed internet connection with a minimum 100 MBps download speed and 20 MBps upload speed. Liberty Mutual does not support satellite and mobile internet service
Qualifications
- 2-3 years sales experience preferred. 2 years of sales/service-related work experience required.
- Strong, engaging interpersonal and persuasion skills needed to close sales.
- Ability to communicate well to both prospects and customers.
- Excellent analytical, decision-making and organizational skills.
- Strong typing capabilities and PC proficiency.
- Property and Casualty License required after hire.
About Us
Pay Philosophy: The typical starting salary range for this role is determined by a number of factors including skills, experience, education, certifications and location. The full salary range for this role reflects the competitive labor market value for all employees in these positions across the national market and provides an opportunity to progress as employees grow and develop within the role. Some roles at Liberty Mutual have a corresponding compensation plan which may include commission and/or bonus earnings at rates that vary based on multiple factors set forth in the compensation plan for the role.
At Liberty Mutual, our goal is to create a workplace where everyone feels valued, supported, and can thrive. We build an environment that welcomes a wide range of perspectives and experiences, with inclusion embedded in every aspect of our culture and reflected in everyday interactions. This comes to life through comprehensive benefits, workplace flexibility, professional development opportunities, and a host of opportunities provided through our Employee Resource Groups. Each employee plays a role in creating our inclusive culture, which supports every inidual to do their best work. Together, we cultivate a community where everyone can make a meaningful impact for our business, our customers, and the communities we serve.
We value your hard work, integrity and commitment to make things better, and we put people first by offering you benefits that support your life and well-being. To learn more about our benefit offerings please visit: https://www.libertymutualgroup.com/about-lm/careers/benefits
Liberty Mutual is an equal opportunity employer. We will not tolerate discrimination on the basis of race, color, national origin, sex, sexual orientation, gender identity, religion, age, disability, veteran's status, pregnancy, genetic information or on any basis prohibited by federal, state or local law.
Fair Chance Notices
- California
- Los Angeles Incorporated
- Los Angeles Unincorporated
- Philadelphia
- San Francisco

100% remote workus national
Title: Program Coordinator
, Wellbeing - Remote - Nationwide
Location: Sacramento United States
Job Description:
Remote, Nationwide - Seeking Program Coordinator, Wellbeing
Everybody Has A Role To Play In Transforming Healthcare
At Vituity you are part of a larger team that is driven by our purpose to improve lives. We are dedicated to transforming healthcare through our culture by working together to tackle healthcare's most pressing challenges from the inside.
Join the Vituity Team. At Vituity we've cultivated an environment where passion thrives, and success comes through shared purpose. We were founded in a culture that values team accomplishments more than inidual achievements, an approach we call "culture of brilliance." Together, we leverage our strengths and experiences to make a positive impact in our local communities. We foster this through shared goals and helping our colleagues succeed, and we also understand the importance of recognition, taking the time to show appreciation and gratitude for a job well done.
Vituity Locations: Vituity has opportunities at 890 practices across the country, serving 14.5 million patients a year. With Vituity, if you ever need to move, you can take your job with you.
The Opportunity
Participate in and help coordinate wellbeing and workforce experience programs, committees, and live events to ensure a positive end user experience such as scheduling, taking notes, tracking attendance, ordering catering, facilitating room set up, troubleshooting issues, overseeing technical support, and creating event materials.
These programs include, but are not limited to: JIM Workgroup meetings, Wellness Committee meetings, virtual webinars, in-person Wellness Fairs.
Serve as a key program contact for established programs and identify ways to increase engagement.
Track meeting and workgroup action items, send reminders, and ensure timely completion of tasks to support program success.
Send invitations and manage event logistics on behalf of the "Wellness Calendar," ensuring all stakeholders are informed, including Feel Good Friday, Virtual Webinar/Education sessions.
Set up Zoom and Team meetings, troubleshoot technical issues, and provide support to speakers to ensure smooth session delivery.
Monitor and analyze attendance and participation trends to assess program effectiveness.
Assist with the design, gathering, and analyzing of program metrics and feedback to measure effectiveness and impact, to ultimately support offering development and enhancement.
Support post-event follow up such as billing, evaluation, metric gathering and analyzing, and supplies inventory.
Brainstorm and research new ideas, tools, techniques, and cost-effective solutions and provide recommendations on potential usage with our programs to address goals and problems.
Coordinate with external vendors, wellness providers, and community partners to enhance wellness related offerings and expand resources available to employees.
Assist with special projects as needed.
Manage complex calendars, prioritize appointments, and coordinate scheduling time and availability.
Schedule internal and external meetings, prepare agendas, and ensure all logistics are handled efficiently and professionally.
Arrange travel accommodations as needed and handle any related logistics to ensure smooth and organized travel experiences.
Prepare and edit professional correspondence, communications, reports, presentations, and other documents on behalf of senior-level leaders.
Complete senior-level leaders' expense reports and track for reimbursement.
Organize, update, and maintain SharePoint sites and Yammer, ensuring information remains current and easily accessible.
In collaboration with subject matter experts, create and edit emails, newsletters, reports, job aids, infographics, presentations, flyers, process documentation, and newsletter announcements.
Assist with development and coordination of messaging across multiple channels to effectively promote wellness programs and increase engagement.
Identify and support ways to streamline communication of offerings across populations.
Edit and distribute event recordings.
Partner with other teams and workgroups on continuously improving administrative processes, and activities cross-functionally to create best possible learning experience for users.
Help track training completion status and follow up with managers and users as needed.
Represent Vituity Wellbeing at Partnership-wide meetings (Symposia and Partnership meetings); staffing resource booth, promoting wellness, and answering questions.
Required Experience and Competencies
- High School Diploma or GED equivalent required.
- Two (2) years of administrative or office support, administrative analyst, or project/ or department coordination/support role required.
- Some college or equivalent experience required.
- Previous customer service experience preferred.
- 3-4 years of increasingly complex administrative support and project coordination experience preferred.
- Bachelor's degree preferred.
- Ability to work independently with drive and initiative but also work well within a teamwork setting.
- Detail-oriented, organized, and flexible inidual able to perform multiple tasks with varying priorities under conditions requiring speed and accuracy.
- General knowledge of administrative procedures and standard business office practices.
- Must have strong customer service with client interactions both verbally and written.
- Strong analytical skills, creative conceptualization, collaborative management ability, and oral and written communication skills.
- Demonstrated ability to handle detailed work accurately and quickly, work to deadlines on multiple projects, and to work as a team member in a collaborative and participatory manner, and to interact both in person and over the phone with a courteous and professional demeanor.
- Strong customer service skills.
- Strong verbal and written communication skills.
- Ability to use office equipment and automated systems/applications/software at an acceptable level of proficiency.
- Ability to establish and maintain effective working relationships as required by the duties of the position.
- Ability to read, understand, and communicate in English sufficient to perform the duties of the position.
- Intermediate to advanced MS Excel, Word, PowerPoint, and Outlook skills.
- Proficiency in Microsoft Office Suite, including Word, Excel, Outlook, and PowerPoint.
- Willingness to travel occasionally for meetings and events.
The Community
Even when you are working remotely, you are an important part of the Vituity Community. We offer plenty of opportunities to engage with other Vitans through a variety of virtual meet-and-greets, events and seminars.
- Monthly wellness events and programs such as yoga, HIIT classes, and more
- Trainings to help support and advance your professional growth
- Team building activities such as virtual scavenger hunts and holiday celebrations
- Flexible work hours
- Opportunities to attend Vituity community events including LGBTQ+ History, Día de los Muertos Celebration, Money Management/Money Relationship, and more
Benefits & Beyond*
Vituity cares about the whole you. With our comprehensive compensation and benefits package, we are mindful of what matters most, and support your needs of today and your plans for the future.
- Superior health plan options
- Dental, Vision, HSA/FSA, Life and AD&D coverage, and more
- Top Tier 401(k) retirement savings plans that offers a $1.20 match for every dollar up to 6% plus discretionary profit-sharing contributions (eligible January following 18 months of service)
- Generous paid time off starting 3-4 weeks' annually
- Student Loan Refinancing Discounts
- Professional and Career Development Program
- EAP and travel assistance included
- Wellness program
- Purpose-driven culture focused on improving the lives of our patients, communities, and employees
We are excited to share the base salary range for this position is $24.28 - $30.36, exclusive of fringe benefits or potential bonuses. This position is also eligible to participate in our annual corporate Success Sharing bonus program, which is based on the company's annual performance. If you are hired at Vituity, your final base salary compensation will be determined based on factors such as skills, education, and/or experience. We believe in the importance of pay equity and consider internal equity of our current team members as a part of any final offer. Please speak with a recruiter for more details.
We are unified around the common purpose of transforming healthcare to improve lives and we believe everyone has a role to play in that. When we work together across sites and specialties as an integrated healthcare team, we exceed the expectations of our patients and the hospitals and clinics we work in. If you are looking to make a difference, from clinical to corporate, Vituity is the place to do it. Come grow with us.
Vituity does not discriminate against any person on the basis of race, creed, color, religion, gender, sexual orientation, gender identity/expression, national origin, disability, age, genetic information (including family medical history), veteran status, marital status, pregnancy or related condition, or any other basis protected by law. Vituity is committed to complying with all applicable national, state and local laws pertaining to nondiscrimination and equal opportunity.
- Benefits for part-time and per diem vary. Please speak to a recruiter for more information.
Applicants only. No agencies please.

100% remote worktx
Title: Sales Representative, Inbound Remote
Job Category
Sales - Inside/Call Center
Typical Starting Salary $55,000-$75,000
Minimum Salary $55,000.00
Maximum Salary $75,000.00
Schedule Full-Time
Flexible Time Off Annual Accrual - days 15
Job Description:
Training Classes Begin in June 2026!
Are you ready to launch a rewarding career in insurance sales? We're seeking motivated, people-focused iniduals to join our Inside Sales Representative team. Secure your spot early for our upcoming 2026 training cohorts and take the first step toward a meaningful, growth‑oriented role.
Key Date:
- Licensed Class: June 1, 2026
- Unlicensed Class: June 29, 2026
Start your journey with us and build a career where your talent and passion for helping others truly make an impact.
As an Inside Sales Representative at Liberty Mutual, you'll have the tools, training and support you need to succeed from day one.
Plus, you'll enjoy:
- Generous earning potential
- Paid licensing and training opportunities
- Comprehensive benefits
- Flexible work arrangements
- Strong work-life balance
- And more!
Why Liberty Mutual?
Pay Details:
- Starting base salary is $45K with opportunity for growth.
- Average earnings range from $55K-$75K through a combination of base salary and generous commission.
- Top Performing Agents in their second year and onward, can earn up to $85k+.
Our Sales Representative, Inbound Remote position is available for candidates based in the state of Texas. Applicants must reside within the specified location to be considered for this role.
Positivity. Flexibility. Determination and a persuasive personality. Qualities like these cannot be taught. But they can be sharpened, strengthened, and appropriately compensated when you join Liberty Mutual Insurance as a part of our Contact Center Sales Organization. Bring your unique sales talent to our Fortune 100 company and receive paid-training, licensing in all 50 states, and a dynamic role that directs only warm leads your way (no cold calls) - because we believe in supporting your success, not holding it back. Join our sales team and realize the rewards of a career with unlimited earning potential, generous commissions, and a portfolio of benefits that start on day one.
Job Details
As an Inside Sales Agent you will be handling inbound calls and warm leads, consulting with customers on their insurance needs and match the correct coverages, products, and benefits to convert sales leads into policyholders.
You'd be a great fit if you are:
A Passionate Seller: When a lead comes in, you skillfully pick up the phone and use your sales expertise to turn prospects into happy, confident Liberty Mutual policyholders.
A Front Lines Liaison: You rise to the role of representing the Liberty brand, you believe in what you're selling, and you enjoy connecting customers to the right products for their inidual needs.
A Reliable Teammate: Whether you work at the office or from home, you adapt well to different environments, schedules, and the varying needs of our policyholders.
A Customer-Centric Closer: While sales is in your title, integrity is in your nature. That means you sincerely care that our customers get exactly the quality products and services they need to embrace today and confidently pursue tomorrow.
Position Details:
From day one you will begin paid training in a remote work environment. All insurance representatives need to hold a Property & Casualty Insurance license. If you do not have one, no worries, paid training also includes licensing!
- Training extends over a period of 16 weeks for licensed hires and 18 weeks for unlicensed hires.
- Comprehensive medical benefits from Day 1.
- No cold calls, all incoming warm leads.
- Opportunities for rewards and recognition.
- Must be available to work a schedule of 4 weekdays and 1 weekend day with a mid-morning start time. Example 11am-8pm (CST). This schedule can be expected for a minimum of 12 months before consideration for another shift.
- All computer equipment is provided. You must be able to maintain department. Work at home (W@H) requirements which include a professional workspace/room with a dedicated desk and wired (cable, fiber of DSL service) high-speed internet connection with a minimum 100 MBps download speed and 20 MBps upload speed. Liberty Mutual does not support satellite and mobile internet services.
Qualifications
- 2-3 years sales experience preferred. 2 years of sales/service-related work experience required.
- Strong, engaging interpersonal and persuasion skills needed to close sales.
- Ability to communicate well to both prospects and customers.
- Excellent analytical, decision-making and organizational skills.
- Strong typing capabilities and PC proficiency.
- Property and Casualty Insurance License. Training will be provided if you do not currently hold a license.
About Us
Pay Philosophy: The typical starting salary range for this role is determined by a number of factors including skills, experience, education, certifications and location. The full salary range for this role reflects the competitive labor market value for all employees in these positions across the national market and provides an opportunity to progress as employees grow and develop within the role. Some roles at Liberty Mutual have a corresponding compensation plan which may include commission and/or bonus earnings at rates that vary based on multiple factors set forth in the compensation plan for the role.
At Liberty Mutual, our goal is to create a workplace where everyone feels valued, supported, and can thrive. We build an environment that welcomes a wide range of perspectives and experiences, with inclusion embedded in every aspect of our culture and reflected in everyday interactions. This comes to life through comprehensive benefits, workplace flexibility, professional development opportunities, and a host of opportunities provided through our Employee Resource Groups. Each employee plays a role in creating our inclusive culture, which supports every inidual to do their best work. Together, we cultivate a community where everyone can make a meaningful impact for our business, our customers, and the communities we serve.
We value your hard work, integrity and commitment to make things better, and we put people first by offering you benefits that support your life and well-being. To learn more about our benefit offerings please visit: https://www.libertymutualgroup.com/about-lm/careers/benefits
Liberty Mutual is an equal opportunity employer. We will not tolerate discrimination on the basis of race, color, national origin, sex, sexual orientation, gender identity, religion, age, disability, veteran's status, pregnancy, genetic information or on any basis prohibited by federal, state or local law.
Fair Chance Notices
- California
- Los Angeles Incorporated
- Los Angeles Unincorporated
- Philadelphia
- San Francisco
Updated about 7 hours ago
RSS